DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31787 and sel-9

DIOPT Version :9

Sequence 1:NP_724105.1 Gene:CG31787 / 318941 FlyBaseID:FBgn0051787 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001370673.1 Gene:sel-9 / 179213 WormBaseID:WBGene00004766 Length:203 Species:Caenorhabditis elegans


Alignment Length:219 Identity:47/219 - (21%)
Similarity:90/219 - (41%) Gaps:35/219 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 WLLQLLLLLDLKFSNAEPHNKQLTVFAEAGRQECFYQPIATTENIKIDYQVIHGGLGETHINFNL 73
            |:|.:|.:...         ....:..:|..::||:..:.:...:.:.::|..||.  ..|:..:
 Worm     6 WILAVLFVTPA---------ASYFIHVDANEEQCFFDRLTSGTKMGLMFEVAEGGF--LDIDVKI 59

  Fly    74 MDPSRRLLIAETKRQMGKHSIQANETGSYKFCFDNTISTFNQKIVSFTLEV------APADREER 132
            ..|..:.:....:...||.:..|:..|.|.:||.|.:||...|.|.||:|:      ||.....:
 Worm    60 TGPDNKEIYKGERESSGKFTFAAHMDGVYTYCFGNKMSTMTPKAVMFTVEITEPHQQAPGAAANQ 124

  Fly   133 ELRDLRQEMLTDYHFDVAYTGIDSYVGKIHVNLMRSRQTQDFIRAIEARDRNVAESTYSMVNKWS 197
            :..|..:              ::..|.::...||..:..|:::...|...||:.|:|.|.|  ..
 Worm   125 DAADNAK--------------LEEMVRELSSALMSVKHEQEYMEVRERVHRNINENTNSRV--VM 173

  Fly   198 WAQFLSMIFVGFL--QVLMVRSIF 219
            ||.|.:.:.||..  |:..::..|
 Worm   174 WAAFEAFVLVGMTVGQIFYLKRFF 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31787NP_724105.1 EMP24_GP25L 30..220 CDD:279450 44/198 (22%)
sel-9NP_001370673.1 EMP24_GP25L 21..198 CDD:395878 44/195 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.