DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31787 and tmed6

DIOPT Version :9

Sequence 1:NP_724105.1 Gene:CG31787 / 318941 FlyBaseID:FBgn0051787 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_005163268.1 Gene:tmed6 / 101884766 ZFINID:ZDB-GENE-131121-182 Length:240 Species:Danio rerio


Alignment Length:209 Identity:48/209 - (22%)
Similarity:88/209 - (42%) Gaps:38/209 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 TVFAEAGRQECFYQPIATTENIKIDY--QVIHGGLGETHINFNLMDPSRRLLIAETKRQMGKHSI 94
            ::...|...:||:......|:..:::  |::.|...:.|::..:..|| .|::.:.....|:.:.
Zfish    39 SIMLRAADLQCFWHFAHYGEHFYLNFMVQLVTGVALDRHLSVMVNAPS-GLIVGKVDDASGQIAF 102

  Fly    95 QANETGSYKFCFDNTISTFN--QKIVSF--------TLEVAPADREERELRDLRQEMLTDYHFDV 149
            ...|||.|:.||.|..:.|.  |..:.|        ..|....|.::|:..||:|       .:.
Zfish   103 SVKETGFYQMCFSNFHNRFGSMQVFLDFGVYYDGQENAEKRKEDEKKRKEEDLKQ-------INS 160

  Fly   150 AYTGIDSYVGKI---------HVNLMRSRQTQDFIRAIEARDRNVAESTYSMVNKWSWAQFLSMI 205
            ..:.|:...|::         |.|..|.|:..||.         :.:|..|.::.||.||.|.:|
Zfish   161 TLSVIEESSGRLQRFVFHMWRHYNYERMRRGADFY---------LLQSNSSYISSWSAAQSLMII 216

  Fly   206 FVGFLQVLMVRSIF 219
            ..|.||:..:|.:|
Zfish   217 SAGVLQLWGIRRLF 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31787NP_724105.1 EMP24_GP25L 30..220 CDD:279450 48/209 (23%)
tmed6XP_005163268.1 EMP24_GP25L 37..231 CDD:279450 48/209 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1693
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D501818at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.