DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31787 and si:ch211-255i20.3

DIOPT Version :9

Sequence 1:NP_724105.1 Gene:CG31787 / 318941 FlyBaseID:FBgn0051787 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_003199913.2 Gene:si:ch211-255i20.3 / 100535182 ZFINID:ZDB-GENE-141216-113 Length:220 Species:Danio rerio


Alignment Length:213 Identity:48/213 - (22%)
Similarity:83/213 - (38%) Gaps:50/213 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VFAEAGRQE--CFYQ--PIAT--TENIKIDY--QVIHGGLGETHINFNLMDPSRRLLIAETKRQM 89
            ::.:.|.||  |..:  |:.|  |...:::|  :.......:..:...:.||...:::.:...:.
Zfish    26 MYFDLGEQEEKCIIEEIPVDTLVTGVFRLEYWDENKKSNTPQLGLTVTVRDPQHEVVLLKRFGRY 90

  Fly    90 GKHSIQANETGSYKFCFDNTISTFNQKIVSFTLEVAPADREERELRDLRQEMLTDYHFDV---AY 151
            ||.:..:..:|.:..|..:..:.|:         |...||             ...|.||   .:
Zfish    91 GKFTFTSPASGQHFLCMQSNSTRFS---------VFAGDR-------------LKVHLDVQMGEH 133

  Fly   152 TGIDSYVGK-------IHVNL------MR--SRQTQDFIRAIEARDRNVAESTYSMVNKWSWAQF 201
            | ||....|       :..||      ||  ||| |||.|..|.:.|.::|.|...|..|:..|.
Zfish   134 T-IDPNAAKTKDTIKAMEYNLQHLIDQMRYISRQ-QDFQREREEKFRQMSEETNGNVLWWAIIQT 196

  Fly   202 LSMIFVGFLQVLMVRSIF 219
            ..::.|||.|:..::..|
Zfish   197 SILLSVGFWQMKNLKDFF 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31787NP_724105.1 EMP24_GP25L 30..220 CDD:279450 48/213 (23%)
si:ch211-255i20.3XP_003199913.2 EMP24_GP25L 25..214 CDD:279450 47/211 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585523
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.