DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31787 and TMED7-TICAM2

DIOPT Version :9

Sequence 1:NP_724105.1 Gene:CG31787 / 318941 FlyBaseID:FBgn0051787 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001157940.1 Gene:TMED7-TICAM2 / 100302736 HGNCID:33945 Length:404 Species:Homo sapiens


Alignment Length:190 Identity:57/190 - (30%)
Similarity:82/190 - (43%) Gaps:24/190 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLQLLLLLDLKFSNAEPHNKQLTVFAEAGRQECFYQPIATTENIKIDYQVIHGGLGETHINFNLM 74
            ||.||||:......:|     :|.......::|||:.||......:::|||.|  |...::..|.
Human    21 LLALLLLVPGPGGASE-----ITFELPDNAKQCFYEDIAQGTKCTLEFQVITG--GHYDVDCRLE 78

  Fly    75 DPSRRLLIAETKRQMGKHSIQANETGSYKFCFDNTISTFNQKIVSFTLEVA---PADREERELRD 136
            ||..::|..|.|:|....:..|::.|:|||||.|..|||..|.|.|..:|.   |....|..:. 
Human    79 DPDGKVLYKEMKKQYDSFTFTASKNGTYKFCFSNEFSTFTHKTVYFDFQVGEDPPLFPSENRVS- 142

  Fly   137 LRQEMLTDYHFDVAYTGIDSYVGKIHVNLMRSRQTQDFIRAIEARDRNVAESTYSMVNKW 196
                         |.|.::|....||..|......|...|..||:.|:.||...:.|..|
Human   143 -------------ALTQMESACVSIHEALKSVIDYQTHFRLREAQGRSRAEDLNTRVAYW 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31787NP_724105.1 EMP24_GP25L 30..220 CDD:279450 50/170 (29%)
TMED7-TICAM2NP_001157940.1 EMP24_GP25L 36..189 CDD:279450 50/173 (29%)
TIR_2 250..>341 CDD:304906
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1693
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103696
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1790
SonicParanoid 1 1.000 - - X1789
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.