DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31784 and ccdc96

DIOPT Version :9

Sequence 1:NP_724035.2 Gene:CG31784 / 318939 FlyBaseID:FBgn0051784 Length:763 Species:Drosophila melanogaster
Sequence 2:NP_001122170.1 Gene:ccdc96 / 559167 ZFINID:ZDB-GENE-081022-156 Length:479 Species:Danio rerio


Alignment Length:557 Identity:113/557 - (20%)
Similarity:205/557 - (36%) Gaps:151/557 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 EFETEKEF-----TVSDQESDVEDPEDKKQSERIRFLEIFGSLPDINNLSASESVESIQLIKEKE 296
            |:..|:.|     |:.:....:|.|.|.:|                              :.|:|
Zfish     7 EYTHEESFVLETDTLMENTKTLEGPADAEQ------------------------------VMEEE 41

  Fly   297 KVLPAVKNDRDQKEPDSFADLQVED-EYTENLDQKTHSLEISSESLIETD--------------- 345
            ...|...|:.:..|.|....|..|| ...|..:|:|..::|....:.|.|               
Zfish    42 TEEPEAPNNPEAVEEDKAEQLLTEDTSVPETSEQQTGEIQIEQHLITEEDPLMNETLEDTEGPET 106

  Fly   346 EEIYNDIVPEESQDNDISGHLLSIQIRSTIL-------DASTSDLFNEIHMTNVAMVEQFLTGLI 403
            |....|...||.::.|....|.:.:..:...       .|.|.|             |:....:|
Zfish   107 EPSLEDSEDEEEEEEDEENSLPAPEPENERSISPPEEPQAHTED-------------EEVDPSII 158

  Fly   404 NEVVKYDERTSVRLRRLLDKEKMLEELYLLVIDYQYEMHRNQALERSVADYYVRRKEFSLVSEDK 468
            .|.::.       |.:|..:.:.|.::             ||.|:..:|:::.::|....|..|:
Zfish   159 KEKMEL-------LHKLQSENEKLNKI-------------NQQLQTRIAEHFSKKKGDQHVKLDE 203

  Fly   469 QIDTINR-ERLMSALVEL-----------DNRLEQVQLTEKLSVKQVNTLIEKEEEARALDAQII 521
            .|....: |:.|..:.::           ..|:|.:.|.....:|||      |:|.|...|   
Zfish   204 DISEQEQYEKYMQLIADMKEQQLHFSKLHQERMEDLHLQSSEKLKQV------EQELRFFAA--- 259

  Fly   522 AKFEAKVRETLC-----KEGLDRITIVVNDLLKKMNKTRDETSDVRKELLFVQHRLQALKNKSEK 581
            .|:|..::.:|.     :|.|.::.::..:.||:.:|           |:.|:.....||||..|
Zfish   260 LKYETVMKASLTGKVGKQETLAKVELLKAEELKQEDK-----------LVCVRLNNIKLKNKISK 313

  Fly   582 LE-------NLGDGLRVLEYISNQARNNALRLKIKEKELELKRFRDRKTYDVHALAHLKNKKKIN 639
            .|       .|.|||.::::...:..|.:...|::|:..||.|.:.:....|..::|:|.|....
Zfish   314 YERALRSKRELVDGLLLMDFEQLKTENQSFMDKLEERSEELHRLKKKVASSVQGISHVKEKLHFM 378

  Fly   640 EELLNNMKSKLRTQQKLEKDLRARHYREMVK-----HEWVKKKILKLKRAGCLMHYPDLLLDYDA 699
            :     |::|.:..|..:.|......||::.     .:.::...|||::...||....||.||:.
Zfish   379 Q-----MENKAKHTQLAQTDTLVALKREVLTRTRQVRDGLRTDNLKLQQRSGLMGNTTLLQDYEE 438

  Fly   700 ---TVNHLQSKRLVVRKLRHEHLRLEERLSEVDTHIK 733
               |..:||.|   :..|:..|..|..:.:.|...||
Zfish   439 KMDTSENLQQK---LEMLKKHHAELSMKCAGVQRKIK 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31784NP_724035.2 DUF4201 551..727 CDD:290581 45/190 (24%)
ccdc96NP_001122170.1 DUF4201 290..466 CDD:290581 47/194 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.