DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31784 and SBSN

DIOPT Version :9

Sequence 1:NP_724035.2 Gene:CG31784 / 318939 FlyBaseID:FBgn0051784 Length:763 Species:Drosophila melanogaster
Sequence 2:NP_001159506.1 Gene:SBSN / 374897 HGNCID:24950 Length:590 Species:Homo sapiens


Alignment Length:31 Identity:11/31 - (35%)
Similarity:18/31 - (58%) Gaps:3/31 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   643 LNNMKSKLRTQQKLEKDLRA-RHYREMVKHE 672
            |:||.|  .|.::|:|.::. .|..:.|.||
Human    72 LSNMGS--HTGKELDKGVQGLNHGMDKVAHE 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31784NP_724035.2 DUF4201 551..727 CDD:290581 11/31 (35%)
SBSNNP_001159506.1 Glutenin_hmw <146..>522 CDD:281191
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..213
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..266
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 297..338
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 545..570
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EAT3
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.