Sequence 1: | NP_724035.2 | Gene: | CG31784 / 318939 | FlyBaseID: | FBgn0051784 | Length: | 763 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_757342.2 | Gene: | Sbsn / 282619 | MGIID: | 2446326 | Length: | 682 | Species: | Mus musculus |
Alignment Length: | 204 | Identity: | 37/204 - (18%) |
---|---|---|---|
Similarity: | 77/204 - (37%) | Gaps: | 50/204 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 177 HRIFLLKPKKPKIAEIVQNSLAD--------SHNVQVQIVESSESLSSIYFNTTSDSDSKKGLTS 233
Fly 234 ILSEFETEKEFTVSDQESDVEDPEDKKQSERIRFLEIFGSLPDINNLSASESVES--IQLIKEKE 296
Fly 297 KVLPAVKNDRDQ--KEPD------SFADLQVEDEYTENLDQKTHSLEISSESLIETDEEIYNDIV 353
Fly 354 PEESQDNDI 362 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31784 | NP_724035.2 | DUF4201 | 551..727 | CDD:290581 | |
Sbsn | NP_757342.2 | Borrelia_P83 | <462..>600 | CDD:114011 | 31/166 (19%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_2EAT3 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |