DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and prss60.1

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001082915.1 Gene:prss60.1 / 799770 ZFINID:ZDB-GENE-070424-25 Length:387 Species:Danio rerio


Alignment Length:342 Identity:90/342 - (26%)
Similarity:143/342 - (41%) Gaps:78/342 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 CVSTAICCPKNLIIKEPRLIIN----EPITDPQCGFVNSKGVTFSFREEDTGLAQEAEVPWMVAL 124
            |||.|:.    |.::.....:|    .|:.:...|.||               |.:...||.|:|
Zfish     6 CVSLALL----LCVQGSHSQLNVCGLAPLNNRIVGGVN---------------AFDGSWPWQVSL 51

  Fly   125 LDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQ----LPSVDVPIRSI 185
            .......:..||:||....|:||......:|.|.|:|      |..||.|    ...::..:..|
Zfish    52 HSPIYGGHFCGGSLINSEWVLTAAHCLPRITTSSLLV------FLGKTTQQGVNTYEINRTVSVI 110

  Fly   186 VRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDF---SRCIFTGWG--KNSFDDP 245
            ..||.:|.....|::||:.|..::|.|.:|.|:|:  |.:|..|   :....||||  :...:.|
Zfish   111 TVHPSYNNLTNENDIALLHLSSAVTFSNYIRPVCL--AAQNSVFPNGTSSWITGWGNIQLGVNLP 173

  Fly   246 SYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAG-GEPGKDSCEGDGGSPLA---CAI 306
            : ..:|::..:|||....|...|     ....:.|:::||| .:.|:|:|:||.|.|:.   |.:
Zfish   174 A-PGILQETMIPVVPNDQCNALL-----GSGSVTNNMICAGLLQGGRDTCQGDSGGPMVSKQCLV 232

  Fly   307 KDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI------------------TLTTVNMPL 353
                  :..:||.::|..|..|..|.|||.|:....||                  |.::|:|.|
Zfish   233 ------WVQSGITSWGYGCADPYSPGVYTRVSQYQSWINSIIVQNLPGFVLFNSSSTCSSVSMTL 291

  Fly   354 PEE----REEVPYASPT 366
            |..    ...:..||||
Zfish   292 PNSTALPTSSISTASPT 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 69/243 (28%)
Tryp_SPc 113..344 CDD:238113 69/243 (28%)
prss60.1NP_001082915.1 Tryp_SPc 33..264 CDD:214473 72/265 (27%)
Tryp_SPc 34..267 CDD:238113 74/267 (28%)
Somatomedin_B 349..382 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587610
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.