DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and si:dkey-238d18.3

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001373176.1 Gene:si:dkey-238d18.3 / 795978 ZFINID:ZDB-GENE-131127-38 Length:272 Species:Danio rerio


Alignment Length:244 Identity:75/244 - (30%)
Similarity:127/244 - (52%) Gaps:31/244 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 GLAQEAEV---PWMVALLDARTSS--YVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFST 170
            |:.|..:.   ||.|::   :|||  ::.||:||....|:|| ...:....|..|| .|:.|.|:
Zfish    43 GIMQGVDALRWPWQVSI---KTSSGEHLCGGSLINKFWVLTA-AHCQIQARSHYVV-LGQHDRSS 102

  Fly   171 K--TEQLPSVDVPIRSIVRHPGFNLENGANN-VALVFLRRSLTSSRHINPICM-PSAPKNFDFSR 231
            .  |.|:..    |..::.||..|::...|| |.|:.|......:..::|:|: .|:.|....:.
Zfish   103 NDGTVQVKE----IAKVITHPDNNIQTLFNNDVTLLKLSSPAQMTSLVSPVCLASSSSKIVPGTL 163

  Fly   232 CIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGKDSCEG 296
            |:.||||:...:..:  .:|::.::|:|.:..|:|    .:|.. ::.||::||||. |..||:|
Zfish   164 CVTTGWGRTKTELSA--RILQEATIPIVSQSQCKQ----IFGAS-KITNSMICAGGS-GSSSCQG 220

  Fly   297 DGGSPLACAIKDNPQRYELAGIVNFG-VDCGLPGVPAVYTNVANVIEWI 344
            |.|.||.|  :.:...|:: |||::| .||.: ..|.||..|:...:||
Zfish   221 DSGGPLMC--ESSGVWYQV-GIVSWGNRDCRV-DFPLVYARVSYFRKWI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 72/240 (30%)
Tryp_SPc 113..344 CDD:238113 72/240 (30%)
si:dkey-238d18.3NP_001373176.1 Tryp_SPc 52..268 CDD:238113 73/235 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.