powered by:
Protein Alignment CG31780 and mettl7a
DIOPT Version :9
Sequence 1: | NP_723920.1 |
Gene: | CG31780 / 318937 |
FlyBaseID: | FBgn0051780 |
Length: | 464 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001072195.1 |
Gene: | mettl7a / 779641 |
XenbaseID: | XB-GENE-5802614 |
Length: | 245 |
Species: | Xenopus tropicalis |
Alignment Length: | 47 |
Identity: | 15/47 - (31%) |
Similarity: | 22/47 - (46%) |
Gaps: | 5/47 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 299 GSPLACAIKDNPQRYELAG---IVNFGVDCGLPGVPAVYTNVANVIE 342
||.:|.| ||.::...|. :|...|.|.:|..|.|...|..|::
Frog 121 GSLVASA--DNMKQVADASQDVVVCTLVVCSVPNTPKVLEEVWRVLK 165
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.