DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and Prss36

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_017167884.1 Gene:Prss36 / 77613 MGIID:1924863 Length:863 Species:Mus musculus


Alignment Length:308 Identity:88/308 - (28%)
Similarity:135/308 - (43%) Gaps:59/308 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PWMVALLDARTSSYVAGGALIAPHVVITARQ-RTENMT---ASQLVVRAGEWDFSTKTEQLPSVD 179
            ||.|:|  .:...::.||:||||..|::|.. ...|.|   |.:|.|..|     ..::..|...
Mouse    60 PWQVSL--HQGGGHICGGSLIAPSWVLSAAHCFVTNGTLEPADELSVLLG-----VHSQDGPLEG 117

  Fly   180 VPIRSI----VRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDF-SRCIFTGWGK 239
            ..:||:    :......:|.|| ::||:.|.........:.|:|:|.|...|.. :.|..||||.
Mouse   118 AHMRSVATILIPDNYSTVELGA-DLALLRLASPAKLGPSVRPVCLPRASHLFAHGTACWATGWGD 181

  Fly   240 NSFDDPSYMN-VLKKISLPVVQRRTCEQQLRLY-----YGNDFELDNSLMCAGGEPG-KDSCEGD 297
            .....|..:. ||:::.|.::....|:   .||     :...|:|...::|||...| :|:|:||
Mouse   182 VQEAVPLPLPWVLQEVELRLLGEAACQ---CLYSRPGPFNLTFQLLPGMLCAGYPAGRRDTCQGD 243

  Fly   298 GGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWITLTTVNMPLPEEREEVPY 362
            .|.||.|   ::..|:.||||.:||..||....|.|:|.||....||            ||.|..
Mouse   244 SGGPLVC---EDGGRWFLAGITSFGFGCGRRNRPGVFTAVAPYESWI------------REHVMG 293

  Fly   363 ASPTLSAGP-YLNQWNQPNYEWLPTGYPNVNSIPWQLQEANNDLANSQ 409
            :.|    || :.:|..:|            .|.||:.:|.|...|..:
Mouse   294 SEP----GPVFPSQLQKP------------QSGPWEPREENCTFAQPE 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 72/240 (30%)
Tryp_SPc 113..344 CDD:238113 72/240 (30%)
Prss36XP_017167884.1 Tryp_SPc 48..290 CDD:238113 75/255 (29%)
Tryp_SPc 331..532 CDD:389826
Tryp_SPc 607..789 CDD:389826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.