DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and XB5723326

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001037931.1 Gene:XB5723326 / 733551 XenbaseID:XB-GENE-5723327 Length:349 Species:Xenopus tropicalis


Alignment Length:243 Identity:64/243 - (26%)
Similarity:110/243 - (45%) Gaps:27/243 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 EAEVPWMVALLDARTSSY--VAGGALIAPHVVITA----RQRTENMTASQLVVRAGEW---DFST 170
            |.:.||:|::.......|  :..|.::....:|||    :...|....:.|.|..|.:   :...
 Frog    24 EGKWPWIVSIQKKVELGYKHICAGTILNNEWIITAAHCFKDWKEGDPTTPLRVLLGTFYLSEIGL 88

  Fly   171 KTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNF-DFSRCIF 234
            :|:..     .::.:::|..::....:|::||:.|.:.:..|.||...|.|....:. |...|..
 Frog    89 RTQSR-----GVKQLIKHDQYDPITESNDIALIQLDKQVEFSDHIQQACFPKESADLKDLIDCSI 148

  Fly   235 TGWGKNS--FDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGKD-SCEG 296
            .|||...  .|:||  ..|::..:..:..:.|.   :.|.|   .|..:.:|||...|.: :|.|
 Frog   149 AGWGAQGKHLDEPS--QFLQEAQVERIDTKHCN---KWYQG---ILGENHLCAGHRKGPEKTCNG 205

  Fly   297 DGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344
            |.||||.|..|.| ..|.:.||:|:|..||....|.||:.:.:.|:||
 Frog   206 DRGSPLMCRTKKN-NVYSVIGILNWGSGCGQTRSPGVYSPIQSHIKWI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 62/241 (26%)
Tryp_SPc 113..344 CDD:238113 62/241 (26%)
XB5723326NP_001037931.1 Tryp_SPc 25..252 CDD:214473 61/240 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.