DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and Prss44

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_683742.2 Gene:Prss44 / 73336 MGIID:1920586 Length:372 Species:Mus musculus


Alignment Length:231 Identity:73/231 - (31%)
Similarity:114/231 - (49%) Gaps:19/231 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVPIR 183
            ||.|:|...:  .::.||:||:...||||........  ...|..|:.|..:|.    .|.:|::
Mouse   124 PWQVSLQVHK--QHICGGSLISKWWVITAAHCVYGHL--DYAVFMGDADLWSKR----PVRIPVQ 180

  Fly   184 SIVRHPGFN-LENGANNVALVFLRRSLTSSRHINPICMPSAPKNF---DFSRCIFTGWGKNSFDD 244
            .|:.|..|: :....:::|||.|...:..|.:|.|:|:|.  |:|   ..:.|..||||| ..:.
Mouse   181 DIIVHQDFSMMRTVVHDIALVLLAFPVNYSVNIQPVCIPE--KSFLVQPGTLCWVTGWGK-VLEQ 242

  Fly   245 PSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFEL-DNSLMCAGGEPGKDSCEGDGGSPLACAIKD 308
            .....:|::|.|.:::...|.|.|:...||.|.| ....:|...|.|.|:|:||.|.||.|... 
Mouse   243 GRSSRILQEIELNIIRHEKCNQILKDIMGNIFTLVQEGGVCGYNEKGGDACQGDSGGPLVCEFN- 306

  Fly   309 NPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344
              :.:...|||::|:.||..|.|.|||.|:...:||
Mouse   307 --KTWVQVGIVSWGLGCGRIGYPGVYTEVSYYRDWI 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 71/229 (31%)
Tryp_SPc 113..344 CDD:238113 71/229 (31%)
Prss44NP_683742.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..72
Tryp_SPc 111..340 CDD:214473 71/229 (31%)
Tryp_SPc 112..340 CDD:238113 71/229 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.