DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and Tmprss11a

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_038948511.1 Gene:Tmprss11a / 686581 RGDID:1596322 Length:387 Species:Rattus norvegicus


Alignment Length:235 Identity:70/235 - (29%)
Similarity:107/235 - (45%) Gaps:22/235 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PWMVALLDARTSSYVAGGALIAPHVVITARQ--RTENMTASQLVVRAGEWDFSTKTE-QLPSVDV 180
            ||.|:|  .|.:.:..||.||....|:||..  ||.        ....:|..|..|. ..|.:..
  Rat   168 PWQVSL--QRNNIHQCGGTLIGNMWVVTAAHCFRTN--------ANPRQWTLSFGTTINPPLMKR 222

  Fly   181 PIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSRCIF-TGWGKNSFDD 244
            .:|.|:.|..:......:::|||.....:|.|..:..||:|....:|..:..:: ||:|...:..
  Rat   223 EVRRIIMHEKYRPPARDHDIALVQFSPRVTFSDEVRRICLPEPSASFPPNSTVYITGFGALYYGG 287

  Fly   245 PSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPG-KDSCEGDGGSPLACAIKD 308
            .| .|.|::..:.::....|:|  |..|||  |:...:.|||...| .|:|.||.|.||  .::|
  Rat   288 ES-QNELREARVQIISNDVCKQ--RHVYGN--EIKRGMFCAGFLEGIYDACRGDSGGPL--VVRD 345

  Fly   309 NPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWITLTT 348
            :...:.|.|||::|.:||....|.|||.|.....||...|
  Rat   346 DKDTWYLIGIVSWGDNCGQKNKPGVYTQVTYYRRWIASKT 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 67/229 (29%)
Tryp_SPc 113..344 CDD:238113 67/229 (29%)
Tmprss11aXP_038948511.1 SEA 35..133 CDD:396113
Tryp_SPc 156..384 CDD:238113 69/232 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.