DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and LOC683422

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_006252253.1 Gene:LOC683422 / 683422 RGDID:1586868 Length:312 Species:Rattus norvegicus


Alignment Length:267 Identity:78/267 - (29%)
Similarity:124/267 - (46%) Gaps:23/267 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 AQEAEVPWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPS 177
            |..:||||.|.:::..|  ::.||:::....|::|....:.:..:.|.:|.|..|.|||..:...
  Rat    52 ANISEVPWHVGIMNHGT--HLCGGSILNEWWVLSASHCFDQINNANLEIRHGRDDLSTKNVKHEK 114

  Fly   178 VDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSRCIFTGWGKNSF 242
            ||    .::.||.|:.....|::||:.|:..|..|.:..|||.........:..|..||||..:.
  Rat   115 VD----KLILHPKFDDWLLDNDIALLLLKSPLNLSINGIPICTSELSDLRIWKNCWVTGWGITNV 175

  Fly   243 DDPSYMNV-LKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAG-GEPGKDSCEGDGGSPLACA 305
            ........ |:|:.:.:.:...|...|.|       |..:::||| .:.|.|:|:||.|..|.|.
  Rat   176 SGVKVQTTKLQKVQVDLFRWDWCGYVLPL-------LTKNMLCAGTPDGGMDACQGDSGGALVCN 233

  Fly   306 IKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWITLTTVNMPLPEEREEVPYASPTLSAG 370
            .|.|...:...|||::||.||...:|.|||.|:..::||...|.       :...||.....||.
  Rat   234 KKRNINTWYQVGIVSWGVGCGKKNLPGVYTKVSPYLKWIRKQTA-------KAGKPYVYDQDSAC 291

  Fly   371 P-YLNQW 376
            | .|:.|
  Rat   292 PLVLSYW 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 68/232 (29%)
Tryp_SPc 113..344 CDD:238113 68/232 (29%)
LOC683422XP_006252253.1 Tryp_SPc 46..275 CDD:238113 70/235 (30%)
Tryp_SPc 46..272 CDD:214473 68/232 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.