DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and Cela3b

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_080695.1 Gene:Cela3b / 67868 MGIID:1915118 Length:269 Species:Mus musculus


Alignment Length:278 Identity:78/278 - (28%)
Similarity:124/278 - (44%) Gaps:41/278 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 EPITDPQCGFVN-SKGVTFSFREEDTGLAQEAEVPWMVALLDARTSSY--VAGGALIAPHVVITA 147
            :|..:|....|| .:.|..|:             ||.|:|...:..|:  ..||:||.|..|:||
Mouse    19 QPSHNPSSRVVNGEEAVPHSW-------------PWQVSLQYEKDGSFHHTCGGSLITPDWVLTA 70

  Fly   148 RQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVPIRS--IVRHPGFN--LENGANNVALVFLRRS 208
            ..........|:|:...|.......||:    :||.:  :..||.:|  ..:..|::|||.|.||
Mouse    71 GHCISTSRTYQVVLGEHERGVEEGQEQV----IPINAGDLFVHPKWNSMCVSCGNDIALVKLSRS 131

  Fly   209 LTSSRHINPICMPSA----PKNFDFSRCIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLR 269
            ......:...|:|.|    |..   :.|..:|||:.|.:.| ..:.|::..||||....|.:.  
Mouse   132 AQLGDAVQLACLPPAGEILPNG---APCYISGWGRLSTNGP-LPDKLQQALLPVVDYEHCSRW-- 190

  Fly   270 LYYGNDFELDNSLMCAGGEPGKDSCEGDGGSPLACAIKDNPQRYELAGIVNF--GVDCGLPGVPA 332
            .::|  ..:..:::||||:. :..|.||.|.||.|. .|| ..:::.|:.:|  .:.|.....|.
Mouse   191 NWWG--LSVKTTMVCAGGDI-QSGCNGDSGGPLNCP-ADN-GTWQVHGVTSFVSSLGCNTLRKPT 250

  Fly   333 VYTNVANVIEWITLTTVN 350
            |:|.|:..|:||..|..|
Mouse   251 VFTRVSAFIDWIEETIAN 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 68/242 (28%)
Tryp_SPc 113..344 CDD:238113 68/242 (28%)
Cela3bNP_080695.1 Tryp_SPc 27..262 CDD:214473 72/262 (27%)
Tryp_SPc 28..265 CDD:238113 74/264 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.