DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and st14a

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001035441.2 Gene:st14a / 678603 ZFINID:ZDB-GENE-030131-6496 Length:834 Species:Danio rerio


Alignment Length:355 Identity:91/355 - (25%)
Similarity:152/355 - (42%) Gaps:69/355 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ELNQSCGA-----------SNEHQCVPRHMCKVKIEFRMAMTYRNLGCVSTAIC------CPKNL 75
            |||..|.|           |.:.:|..:..|....:        ..||..|..|      |..:.
Zfish   505 ELNCGCRADQFKCKNDKCISEKQKCDGKDDCNDGSD--------EEGCARTDSCLVSTFLCGNSK 561

  Fly    76 IIKEPRLIINEPITDPQ--CG----FVNSKGVTFSFRE------EDTGLAQEAEVPWMVALLDAR 128
            .|.:|     .|..|.|  ||    ..|....|.::::      :|   |.|.|.||.|: |..:
Zfish   562 CITKP-----NPECDGQDDCGDNSDESNCNCGTKAYKKSRIVGGQD---AFEGEFPWQVS-LHIK 617

  Fly   129 TSSYVAGGALIAPHVVITAR---QRTENMTASQLVVRAGEWD----FSTKTEQLPSVDVPIRSIV 186
            ..::|.||::|....::||.   |....:..||    .|.|:    ..::.::|.:....::.::
Zfish   618 NIAHVCGGSIINERWIVTAAHCVQDDVKIKYSQ----PGTWEVFLGLHSQKDKLTATKRLLKQVI 678

  Fly   187 RHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSRCIF-TGWGKNSFDDPSYMNV 250
            .||.:|.....|::||:.:...:|.|..|.|:|:|:|...|.....:| :|||... :..|...|
Zfish   679 PHPYYNAYTYDNDIALMEMESPVTFSDTIRPVCLPTATDTFPAGTSVFISGWGATR-EGGSGATV 742

  Fly   251 LKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGG-EPGKDSCEGDGGSPLACAIKDNPQRYE 314
            |:|..:.::....|.|.:    |.  ::.:.:.|||. ..|.|:|:||.|.||:.   .:.:|..
Zfish   743 LQKAEVRIINSTVCNQLM----GG--QITSRMTCAGVLSGGVDACQGDSGGPLSF---PSGKRMF 798

  Fly   315 LAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344
            |||:|::|..|.....|.:|:||.....||
Zfish   799 LAGVVSWGDGCARRNKPGIYSNVPKFRAWI 828

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 66/239 (28%)
Tryp_SPc 113..344 CDD:238113 66/239 (28%)
st14aNP_001035441.2 SEA 77..168 CDD:279699
CUB 219..322 CDD:238001
CUB 329..431 CDD:238001
LDLa 443..472 CDD:238060
LDLa 474..508 CDD:238060 2/2 (100%)
LDLa 510..544 CDD:238060 5/41 (12%)
LDLa 550..585 CDD:238060 9/39 (23%)
Tryp_SPc 596..828 CDD:214473 67/249 (27%)
Tryp_SPc 597..831 CDD:238113 69/250 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.