DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and TMPRSS3

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_076927.1 Gene:TMPRSS3 / 64699 HGNCID:11877 Length:454 Species:Homo sapiens


Alignment Length:372 Identity:91/372 - (24%)
Similarity:148/372 - (39%) Gaps:82/372 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VQAQGQNAELNQSCGASNEHQCV---PRHMCKVKIEFRMAMTYRNLGCVS---TAICCPKNLII- 77
            |:..||||.|.....||.:..|.   ..|             |.|:.|..   .:.....||.: 
Human   108 VRVGGQNAVLQVFTAASWKTMCSDDWKGH-------------YANVACAQLGFPSYVSSDNLRVS 159

  Fly    78 ------KEPRLIINEPITDPQ--------------------------CGFVNSKGVTFSFREEDT 110
                  :|..:.|:..:.|.:                          ||  :.:|  :|.|....
Human   160 SLEGQFREEFVSIDHLLPDDKVTALHHSVYVREGCASGHVVTLQCTACG--HRRG--YSSRIVGG 220

  Fly   111 GLAQEAEVPWMVALLDARTSSY-VAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQ 174
            .::..::.||..:|   :...| :.||::|.|..:|||.....::...:      .|........
Human   221 NMSLLSQWPWQASL---QFQGYHLCGGSVITPLWIITAAHCVYDLYLPK------SWTIQVGLVS 276

  Fly   175 L---PSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNF-DFSRCIFT 235
            |   |:....:..||.|..:..:...|::||:.|...||.:..|.|:|:|::.:|| |...|..:
Human   277 LLDNPAPSHLVEKIVYHSKYKPKRLGNDIALMKLAGPLTFNEMIQPVCLPNSEENFPDGKVCWTS 341

  Fly   236 GWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAG---GEPGKDSCEGD 297
            |||...........||...::|::..:.|..  |..||.  .:..|::|||   |  |.|||:||
Human   342 GWGATEDGAGDASPVLNHAAVPLISNKICNH--RDVYGG--IISPSMLCAGYLTG--GVDSCQGD 400

  Fly   298 GGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344
            .|.||.|   ...:.::|.|..:||:.|.....|.|||.|.:.::||
Human   401 SGGPLVC---QERRLWKLVGATSFGIGCAEVNKPGVYTRVTSFLDWI 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 66/238 (28%)
Tryp_SPc 113..344 CDD:238113 66/238 (28%)
TMPRSS3NP_076927.1 LDLa 74..107 CDD:238060
SRCR_2 112..210 CDD:292133 19/112 (17%)
Tryp_SPc 216..444 CDD:214473 67/245 (27%)
Tryp_SPc 217..447 CDD:238113 68/246 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.