DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and zgc:123295

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001032651.1 Gene:zgc:123295 / 641564 ZFINID:ZDB-GENE-051127-11 Length:310 Species:Danio rerio


Alignment Length:240 Identity:73/240 - (30%)
Similarity:123/240 - (51%) Gaps:29/240 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFS-------TKTEQLP 176
            ||.|:|.......:..||:||....|::|....:: :...::|:.|....|       |||    
Zfish    48 PWQVSLQSPTYGGHFCGGSLINKDWVLSAAHCFQD-SIGTIMVKLGLQSQSGSNPYQITKT---- 107

  Fly   177 SVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSRCIF-TGWGKN 240
                 :..::.||.:|..:..|::|||.|..|:|.:.:|.|:|:.:|...:......: |||||.
Zfish   108 -----VVQVINHPNYNNPSNDNDIALVKLDSSVTFNDYIEPVCLAAAGNTYAAGTLSWVTGWGKL 167

  Fly   241 SFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAG--GEPGKDSCEGDGGSPLA 303
            |.......::|:::.:|:|....|:   |.|.|   |:.::::|||  .:.|||||:||.|.|: 
Zfish   168 SSAANQIPDILQEVEIPIVSHSDCK---RAYPG---EITSNMICAGLLDQGGKDSCQGDSGGPM- 225

  Fly   304 CAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWITLTT 348
              :..|..::..:|||:||..|..||.|.||..|:...:|||.:|
Zfish   226 --VSRNGSQWIQSGIVSFGRGCAEPGYPGVYARVSQYQDWITSST 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 69/234 (29%)
Tryp_SPc 113..344 CDD:238113 69/234 (29%)
zgc:123295NP_001032651.1 Tryp_SPc 35..264 CDD:214473 69/234 (29%)
Tryp_SPc 36..264 CDD:238113 69/234 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587484
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.