DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and Masp1

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_006248588.1 Gene:Masp1 / 64023 RGDID:620213 Length:733 Species:Rattus norvegicus


Alignment Length:284 Identity:81/284 - (28%)
Similarity:128/284 - (45%) Gaps:56/284 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 REEDTGLAQEAEVPWMVALLDARTS-----SYVAGGALIAPHVVITA-----RQRTEN----MTA 156
            |..:.||     .||...::...||     .:...|||::...::||     .||.:|    ::.
  Rat   459 RNAELGL-----FPWQALIVVEDTSRIPNDKWFGSGALLSESWILTAAHVLRSQRRDNTVIPVSK 518

  Fly   157 SQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMP 221
            ..:.|..|..|...|:   .:|:.....:|.||.||::|..:::|||.|:..:....|:.|||:|
  Rat   519 DHVTVYLGLHDVRDKS---GAVNSSAARVVLHPDFNIQNYNHDIALVQLQEPVPLGAHVMPICLP 580

  Fly   222 ------SAPKNFDFSRCIFTGWGKNSFDDP-------------SYMNVLKKISLPVVQRRTCEQQ 267
                  .||....    :..|||   ..:|             :..:||:.:.||||....|:..
  Rat   581 RPEPEGPAPHMLG----LVAGWG---ISNPNVTVDEIIISGTRTLSDVLQYVKLPVVSHAECKAS 638

  Fly   268 LRLYYGNDFELDNSLMCAG-GEPGKDSCEGDGGSPLACAIKDN-PQRYELAGIVNFG--VDCGLP 328
            .....|| :.:..::.||| .|.|||:|.||.|.  |..|.|. .||:...|:|::|  .:||..
  Rat   639 YESRSGN-YSVTENMFCAGYYEGGKDTCLGDSGG--AFVIFDEMSQRWVAQGLVSWGGPEECGSK 700

  Fly   329 GVPAVYTNVANVIEWITLTTVNMP 352
            .|..|||.|:|.::|: |..:|.|
  Rat   701 QVYGVYTKVSNYVDWL-LEEMNSP 723

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 74/267 (28%)
Tryp_SPc 113..344 CDD:238113 74/267 (28%)
Masp1XP_006248588.1 CUB 33..142 CDD:238001
FXa_inhibition 158..186 CDD:291342
CUB 190..299 CDD:278839
CCP 306..368 CDD:153056
CCP 372..437 CDD:153056
Tryp_SPc 454..715 CDD:214473 77/273 (28%)
Tryp_SPc 455..716 CDD:238113 77/274 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.