DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CELA2A

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_254275.1 Gene:CELA2A / 63036 HGNCID:24609 Length:269 Species:Homo sapiens


Alignment Length:243 Identity:75/243 - (30%)
Similarity:118/243 - (48%) Gaps:26/243 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PWMVALLDARTSS--YVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVP 181
            ||.|:|..:....  :..||:|||...|:||    .:..:|....|.|....:....:..|:.|.
Human    41 PWQVSLQYSSNGKWYHTCGGSLIANSWVLTA----AHCISSSRTYRVGLGRHNLYVAESGSLAVS 101

  Fly   182 IRSIVRHPGFN---LENGANNVALVFLRRSLTSSRHINPICMPSA----PKNFDFSRCIFTGWGK 239
            :..||.|..:|   :..| |::||:.|...::.:..|...|:|.|    |.|:.   |..||||:
Human   102 VSKIVVHKDWNSNQISKG-NDIALLKLANPVSLTDKIQLACLPPAGTILPNNYP---CYVTGWGR 162

  Fly   240 NSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGKDSCEGDGGSPLAC 304
            .. .:.:..:||::..|.||...||...  .::|:  .:..|::||||:....||.||.|.||.|
Human   163 LQ-TNGAVPDVLQQGRLLVVDYATCSSS--AWWGS--SVKTSMICAGGDGVISSCNGDSGGPLNC 222

  Fly   305 AIKDNPQRYELAGIVNFG--VDCGLPGVPAVYTNVANVIEWITLTTVN 350
            ...|.  |:::.|||:||  :.|.....|:|:|.|:|.|:||.....|
Human   223 QASDG--RWQVHGIVSFGSRLGCNYYHKPSVFTRVSNYIDWINSVIAN 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 72/235 (31%)
Tryp_SPc 113..344 CDD:238113 72/235 (31%)
CELA2ANP_254275.1 Tryp_SPc 29..265 CDD:238113 74/238 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.