DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CG18735

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster


Alignment Length:398 Identity:97/398 - (24%)
Similarity:162/398 - (40%) Gaps:78/398 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 MCKVKIEFRMAMTYRNLGCVSTAICCPKNLIIKEPRLIIN--------------EPITDPQ---- 92
            ||...:...:|....:|.|.:     |......:|..|:|              :.|..|:    
  Fly     1 MCNFHLLLILATALGDLACAT-----PSLRSASDPEKILNNLAQLRQSSFLDWIQSILGPEVPAE 60

  Fly    93 -------------CGFVNSKGVTFSFREEDTGLAQEAEV---PWMVALLDARTSSYVAGGALIAP 141
                         ||.:|:       |....| .||.||   |||:.|:  ...::..|.:|:..
  Fly    61 WSSPAKRECAECSCGNINT-------RHRIVG-GQETEVHEYPWMIMLM--WFGNFYCGASLVND 115

  Fly   142 HVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLR 206
            ...:||...........:.||..|  .:.:...:..||..:..::.||.::..|..:::||:...
  Fly   116 QYALTAAHCVNGFYHRLITVRLLE--HNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFN 178

  Fly   207 RSLTSSRHINPICMPSAPKNFDFSRCIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLY 271
            ..:.....::|:|||:..:|:.....:.||||..|...| ..:.|:::.:|::.:..|...   .
  Fly   179 EPVRLGIDMHPVCMPTPSENYAGQTAVVTGWGALSEGGP-ISDTLQEVEVPILSQEECRNS---N 239

  Fly   272 YGNDFELDNSLMCAG--GEPGKDSCEGDGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVY 334
            ||.....|| ::|||  .:.|||||:||.|.|:  .:..:...|:|||||::|..|..|..|.||
  Fly   240 YGESKITDN-MICAGYVEQGGKDSCQGDSGGPM--HVLGSGDAYQLAGIVSWGEGCAKPNAPGVY 301

  Fly   335 TNVANVIEWITLTTVNMPLPEEREEVPYASPTLSAGP-----YLNQWNQPNYEWLPTGYPNVNSI 394
            |.|.:..:||...|        |:....|.|..:..|     ...|.:|.|    .|......:.
  Fly   302 TRVGSFNDWIAENT--------RDACSCAQPEAAGEPASPMETTEQGDQEN----TTANGAAEAD 354

  Fly   395 PWQLQEAN 402
            | :::|||
  Fly   355 P-EVEEAN 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 66/235 (28%)
Tryp_SPc 113..344 CDD:238113 66/235 (28%)
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 67/240 (28%)
Tryp_SPc 83..314 CDD:238113 69/242 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457667
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.