DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and F12

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_067464.2 Gene:F12 / 58992 MGIID:1891012 Length:597 Species:Mus musculus


Alignment Length:262 Identity:80/262 - (30%)
Similarity:124/262 - (47%) Gaps:21/262 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 CGFVNSKGVTFSFREEDTGL-AQEAEVPWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTA 156
            ||....||:: ||.....|| |.....|::.||.   ..:....|:||||..|:||....:|..|
Mouse   341 CGQRFRKGLS-SFMRVVGGLVALPGSHPYIAALY---WGNNFCAGSLIAPCWVLTAAHCLQNRPA 401

  Fly   157 -SQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTS-----SRHI 215
             .:|.|..|:...:...|...:  :.:||...|.||:.....:::||:.|:.|.|:     |.|:
Mouse   402 PEELTVVLGQDRHNQSCEWCQT--LAVRSYRLHEGFSSITYQHDLALLRLQESKTNSCAILSPHV 464

  Fly   216 NPICMPS--APKNFDFSRCIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFEL 278
            .|:|:||  ||.: :...|...|||........|...|::..:|.:....|...  ..:|:  .:
Mouse   465 QPVCLPSGAAPPS-ETVLCEVAGWGHQFEGAEEYSTFLQEAQVPFIALDRCSNS--NVHGD--AI 524

  Fly   279 DNSLMCAGG-EPGKDSCEGDGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIE 342
            ...::|||. |.|.|:|:||.|.||.|.......:..|.|::::|..||....|.|||:|||.:.
Mouse   525 LPGMLCAGFLEGGTDACQGDSGGPLVCEEGTAEHQLTLRGVISWGSGCGDRNKPGVYTDVANYLA 589

  Fly   343 WI 344
            ||
Mouse   590 WI 591

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 70/239 (29%)
Tryp_SPc 113..344 CDD:238113 70/239 (29%)
F12NP_067464.2 FN2 41..88 CDD:238019
EGF_CA 96..131 CDD:238011
FN1 133..173 CDD:238018
EGF 178..206 CDD:278437
KR 217..295 CDD:294073
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..338
Tryp_SPc 354..591 CDD:214473 72/246 (29%)
Tryp_SPc 355..594 CDD:238113 74/247 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.