DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CG34409

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster


Alignment Length:307 Identity:80/307 - (26%)
Similarity:126/307 - (41%) Gaps:43/307 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 STAICCPKNLIIKEPRLIINEPITDPQCGFVNSKGVTFSFREEDTG--LAQEAEVPWMVALLDAR 128
            :|.:..|...|   |..:.....:.|.....|::|...:......|  .|...:.||:..:....
  Fly   210 TTTLATPIETI---PASLSTTTASMPPFAQENTQGCGINVESRLLGGDQASAGQFPWLTRIAYRN 271

  Fly   129 TS----SYVAGGALIAPHVVITARQRTENMTASQLV--VRAGEWDFSTKTEQLPSVDVPIRSIVR 187
            .|    |:...|:||:.:.::||.....|:.:...:  ||.|..|.:|        ...|..::.
  Fly   272 RSSSRISFRCSGSLISSNHIVTAAHCVVNLVSDLELSHVRLGSQDGAT--------PFAIEQVIV 328

  Fly   188 HPGFNLENGANNVALVFLRRSLTSSRHINPICMP-SAPKNFDFSRCI-----FTGWG-----KNS 241
            ||.::....||::||  ||.:.|:.. ..|||:| :.|.... :|.|     ..||.     .||
  Fly   329 HPNYDQPKYANDIAL--LRINSTNGT-FTPICLPFNGPITLG-NRLIGQIGVAAGWSIGSTENNS 389

  Fly   242 FDDPSYMNV-LKKISLPVVQRRTCE---QQLRLYYGNDFELDNSLMCAGGEPGKDSCEGDGGSPL 302
            ..|||.... ::.|.||:|...:|.   ..|...:.....:..:.:||.|.|..|.|.||.|.|.
  Fly   390 SMDPSNSTAGVRFIRLPIVNTTSCAIAYASLSENFQQPIVITPNHLCAQGMPMNDVCRGDSGGPF 454

  Fly   303 ----ACAIKDNPQRYELAGIVNFGVD-CGLPGVPAVYTNVANVIEWI 344
                ...:.....||.:.|||.||.. ||:..:|.|||.|::..:||
  Fly   455 MDDGTSGVFGTSGRYTIIGIVAFGPTLCGVTTIPGVYTLVSSFSDWI 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 70/256 (27%)
Tryp_SPc 113..344 CDD:238113 70/256 (27%)
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 71/263 (27%)
Tryp_SPc 252..501 CDD:238113 71/260 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.