DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CG34436

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster


Alignment Length:288 Identity:80/288 - (27%)
Similarity:120/288 - (41%) Gaps:51/288 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 ITDPQCGFVN--SKGVTFSFREEDTGLAQEAEVPWM-VALLDARTSSYVAGGALIAPHVVITARQ 149
            :.|..|..|:  |..:.||             .||| :.||..:|.|    ||||..:.|||:..
  Fly    22 LLDQNCAEVSRLSNDIIFS-------------RPWMALVLLPNKTCS----GALIHKYFVITSAS 69

  Fly   150 RTENMTASQLVVRAGEWDFSTKTEQLPSV---DVPIRSIVRHPGFNLENGANNVALVFLRRSLTS 211
            ...|.  .:.:||.|:  .|.|.|.:.|.   |..::|...|..:...|..:::||:.|:..:..
  Fly    70 CVFNQ--ERAIVRLGQ--LSIKQEHIVSYSSDDYHVQSAYIHRFYEKSNFEHDIALLELQNDVLY 130

  Fly   212 SRHINPICMPSAPKNFD---FSRCIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYG 273
            ..||.|||:.....:.|   |.|.....||   .|:...:...|...:..:.:..||...:||  
  Fly   131 KAHIRPICLWLDKSDIDTQMFKRYETFRWG---IDEKYILPAAKTSKIKHISQVKCENAFKLY-- 190

  Fly   274 NDFELDNSLMCAGGEPGKDSCEGDGGSPLACAIKDNPQ-RYELAGIVNFGVD--CGLPGVPAVYT 335
                ..||.:|||.: .|..|. :.||||...|:...: ||.|.||.::|..  |       :||
  Fly   191 ----PQNSHICAGYK-NKSKCV-ETGSPLFKKIRYYTKIRYTLFGIQSYGESRTC-------LYT 242

  Fly   336 NVANVIEWITLTTVNMPLPEEREEVPYA 363
            :|...|:||.....|:.:.....|..||
  Fly   243 DVTKYIDWIMGVIQNVNVIVSNGENSYA 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 68/240 (28%)
Tryp_SPc 113..344 CDD:238113 68/240 (28%)
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:304450 70/250 (28%)
Tryp_SPc 40..251 CDD:214473 69/249 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.