DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and si:dkeyp-93a5.3

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_021326347.1 Gene:si:dkeyp-93a5.3 / 571565 ZFINID:ZDB-GENE-131127-100 Length:328 Species:Danio rerio


Alignment Length:244 Identity:69/244 - (28%)
Similarity:116/244 - (47%) Gaps:33/244 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVPIR 183
            ||||: |..|...: .||:||....|:||.....:.|.|.::|..|:|  .:....:.|:...||
Zfish    48 PWMVS-LQGRYGHF-CGGSLINNQWVLTAAHCIVDQTPSSIIVYLGKW--RSYVADVNSISRTIR 108

  Fly   184 SIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSR---CIFTGWGKNSFDDP 245
            .|:.||.::.....|::||:.|..::..:.:|.|||:  |.:|.:|.|   ....|||.......
Zfish   109 HIIPHPSYSNITKDNDIALLQLTSTVQYTDYIKPICL--ADENSNFPRGTNSWVAGWGDIGVLGT 171

  Fly   246 SYMNVLKKISLP-----VVQRRTCEQQLRLYYGNDF------ELDNSLMCAGGEP-GKDSCEGDG 298
            ..:.....:|:|     ::|    |.:|::|...|.      .:..:::|||..| ||.:..||.
Zfish   172 GGIRGRTTVSVPLPHPGILQ----EAELKVYSNADCNNICHGRITPNMICAGTRPGGKATFSGDS 232

  Fly   299 GSPL--ACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWIT 345
            |.||  .|::      :..||:::.|..|..|.:|.|:..|:...:|||
Zfish   233 GGPLMTKCSV------WVQAGVLSHGYGCAQPNLPEVFIRVSEYKQWIT 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 66/241 (27%)
Tryp_SPc 113..344 CDD:238113 66/241 (27%)
si:dkeyp-93a5.3XP_021326347.1 Tryp_SPc 36..274 CDD:238113 66/241 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.