DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and tmprss5

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_009289870.1 Gene:tmprss5 / 569688 ZFINID:ZDB-GENE-131121-184 Length:551 Species:Danio rerio


Alignment Length:239 Identity:71/239 - (29%)
Similarity:113/239 - (47%) Gaps:31/239 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTASQL---VVRAGEWDFSTKTEQLPSV-- 178
            ||.|:|.  ..:.::.||::|....::||.....|....|:   ||.||     ..|..|..:  
Zfish   324 PWQVSLY--YNNRHICGGSIITNQWIVTAAHCVHNYRLPQVPSWVVYAG-----IITSNLAKLAQ 381

  Fly   179 --DVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDF-----SRCIFTG 236
              ...:..|:.:..:|.....|::|||.|:..|..|..|.|:|:|    .:|.     ::|..:|
Zfish   382 YQGFAVERIIYNKNYNHRTHDNDIALVKLKTPLNFSDTIRPVCLP----QYDHDLPGGTQCWISG 442

  Fly   237 WGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGK-DSCEGDGGS 300
            ||....||.....|||:..:|::..:.|.... :|.|   |:.:.::|||...|| |:|:||.|.
Zfish   443 WGYTQPDDVLIPEVLKEAPVPLISTKKCNSSC-MYNG---EITSRMLCAGYSEGKVDACQGDSGG 503

  Fly   301 PLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344
            ||.|   .:...:.|.|:|::|..|..|..|.||:.||..:.||
Zfish   504 PLVC---QDENVWRLVGVVSWGTGCAEPNHPGVYSKVAEFLGWI 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 69/237 (29%)
Tryp_SPc 113..344 CDD:238113 69/237 (29%)
tmprss5XP_009289870.1 SRCR_2 211..306 CDD:292133
Tryp_SPc 311..544 CDD:214473 69/237 (29%)
Tryp_SPc 312..547 CDD:238113 71/239 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.