DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and hpn

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001091657.2 Gene:hpn / 569259 ZFINID:ZDB-GENE-141212-373 Length:425 Species:Danio rerio


Alignment Length:418 Identity:96/418 - (22%)
Similarity:168/418 - (40%) Gaps:102/418 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IIAIVSLILV---------------------AG----QVQAQGQNAELNQS--------CGASNE 38
            ::|.|||||:                     .|    ||.|..|...:..|        | :|:.
Zfish    21 VVAAVSLILIILGGLGAAIWALVTYLRTTEDTGLFDVQVSAADQRLRVFDSTQWRWKYVC-SSSV 84

  Fly    39 HQCVPRHMCKVKIEFRMAMTYRNLGCVSTAICCPKN------LIIKEPRLIINEPITDPQCGFVN 97
            :|.:....|: ::.|..|:.:       :..|.|::      ..:||..|...:.|.........
Zfish    85 NQLIANITCE-EMGFVRAVNF-------SVTCAPESGGDRDFFCVKESELTYGKKIKTALYPCKC 141

  Fly    98 SKGVTFSFREEDTGL-------------AQEAEVPWMVALLDARTSSYVAGGALIAPHVVITA-- 147
            .||.......:|.|.             |::...||.|:|  .....:..||::|:...:|:|  
Zfish   142 DKGQILEVICQDCGRRMLPEERIVGGVDARQGSWPWQVSL--QYDGVHQCGGSIISDRWIISAAH 204

  Fly   148 ----RQRTENMTASQLVVRAGEWD------FSTKTEQLPSVDVPIRSIVRHPGF------NLENG 196
                |.|           .|..|.      ::|...: ..|...::::|.|..:      |:::.
Zfish   205 CFPERYR-----------HASRWRVLMGSIYNTPIRK-NVVIAEVKTVVYHSSYLPFVDANIDDN 257

  Fly   197 ANNVALVFLRRSLTSSRHINPICMPSAPKNF-DFSRCIFTGWGKNSFDDPSYMNVLKKISLPVVQ 260
            :.::|::.|.:.|..:.:|.|:|:|:..:.. |......||||...:.. :..|||::..:|::.
Zfish   258 SRDIAVISLTKPLQFTDYIQPVCLPTYGQRLADGQMGTVTGWGNVEYYG-TQANVLQEAHVPIIS 321

  Fly   261 RRTCEQQLRLYYGNDFELDNSLMCAGGEP-GKDSCEGDGGSPLACA-IKDNPQRYELAGIVNFGV 323
            ...|...  .||.|  ::..::.|||.|. |.|||:||.|.|...| :.....||.|.|:|::|.
Zfish   322 DAVCNGP--DYYDN--QVTTTMFCAGYEKGGTDSCQGDSGGPFVAADVLSKTSRYRLLGVVSWGT 382

  Fly   324 DCGLPGVPAVYTNVANVIEWITLTTVNM 351
            .|.:...|.|||.|:..:.||: |.:.|
Zfish   383 GCAMAKKPGVYTRVSRFLPWIS-TAMRM 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 64/251 (25%)
Tryp_SPc 113..344 CDD:238113 64/251 (25%)
hpnNP_001091657.2 SRCR_2 54..160 CDD:321960 21/114 (18%)
Tryp_SPc 164..404 CDD:238113 65/258 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.