DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and AgaP_AGAP012505

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_001688570.1 Gene:AgaP_AGAP012505 / 5668379 VectorBaseID:AGAP012505 Length:283 Species:Anopheles gambiae


Alignment Length:212 Identity:50/212 - (23%)
Similarity:82/212 - (38%) Gaps:46/212 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ELNQSC--GASNEHQCVPRHMCKVKIEFRMAMTYRNLGCVS-TAICCPKNLIIKEPRLIINEP-- 87
            ||...|  ....:..|.....|. .|..|:....:.:.|.: ..:|||..  ..:||::..|.  
Mosquito    81 ELGDECEYADGTKGTCTAEPSCP-DINARLQNNQQVIFCGNRNVVCCPNK--ATDPRMMAIENEF 142

  Fly    88 ----------ITDPQCGFVNSKGVTFSFREEDTGLAQEAEVPWMVALLDARTSSYVAGGALIAPH 142
                      .||.|.|  :|..|:         :|...|:.|.    |.|.::|...|.||:..
Mosquito   143 NQCEERYRHFTTDQQNG--SSHAVS---------IAYNVEIGWQ----DDRNTTYACYGYLISTR 192

  Fly   143 VVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVD----VPIRSIVRHPGFNLENGANNVALV 203
            .|:::............:||.|..|         |:|    |||..::.||.:|.|...:|:|:|
Mosquito   193 GVVSSASCLSERADLPNIVRIGGID---------SLDNSRVVPIEKVIIHPDYNKETLEHNIAIV 248

  Fly   204 FLRRSLTSSRHINPICM 220
            .|..::..|.::.|.|:
Mosquito   249 KLESTVDPSENVFPTCL 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 30/112 (27%)
Tryp_SPc 113..344 CDD:238113 30/112 (27%)
AgaP_AGAP012505XP_001688570.1 Tryp_SPc 184..>265 CDD:304450 23/89 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.