DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and AgaP_AGAP005688

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_001688707.1 Gene:AgaP_AGAP005688 / 5667341 VectorBaseID:AGAP005688 Length:301 Species:Anopheles gambiae


Alignment Length:257 Identity:60/257 - (23%)
Similarity:109/257 - (42%) Gaps:33/257 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 QEA---EVPWMVALL-DARTSSYVAGGALIAPHVVITARQ---RTENMTASQLVVRAGEWDFSTK 171
            |||   :.|:.:.|| |..|.:.:.||:::..:.::||..   ...|...|..:...|..:.:.:
Mosquito    60 QEATPGQFPYQIILLSDFPTGTALCGGSVLTRNFILTAAHCVVSGTNTVVSGGIAIMGAHNRTIQ 124

  Fly   172 TEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSRCIFT- 235
            ......:......|..||.:.......::|:|.|..|:|.:..|.|:.:|:......|...:.| 
Mosquito   125 EASQQRIRYTASGIRYHPLYVSSTLRYDIAVVLLNSSITFTDRIQPVRLPAQSDTRQFGGFVGTL 189

  Fly   236 -GWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGKDSCEGDGG 299
             |:|:.:....|...|::..|.||:....|..:    :|:. .:.:..:|..|..|:.||.||.|
Mosquito   190 SGFGRTTDASQSISTVVRFTSNPVMTNANCITR----WGSS-NIQDQNVCLSGTGGRSSCNGDSG 249

  Fly   300 SPLACAIKDNPQRYELAGIVNFGV-------DCGLPGVPAVYTNVANVIEWITLTT--VNMP 352
            .||.         .|..|.:..||       .|. .|:|:||:.|:..:.|:.:.:  |:.|
Mosquito   250 GPLT---------VESGGPIQIGVVSFVSIRGCE-AGMPSVYSRVSFYLNWVEINSDFVSQP 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 57/245 (23%)
Tryp_SPc 113..344 CDD:238113 57/245 (23%)
AgaP_AGAP005688XP_001688707.1 Tryp_SPc 55..291 CDD:214473 57/245 (23%)
Tryp_SPc 56..292 CDD:238113 58/246 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.