DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CLIPC6

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_001687772.2 Gene:CLIPC6 / 5666762 VectorBaseID:AGAP000315 Length:361 Species:Anopheles gambiae


Alignment Length:396 Identity:97/396 - (24%)
Similarity:148/396 - (37%) Gaps:107/396 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IAIVSLILVAG----QVQAQGQNAELNQ-SCGASNEHQCVPRHMCKVKIEFRMAMTYRNLGC--- 64
            |.::.|:::.|    |...:|...||.. |.|...:....|..:..:....|.|   ..:.|   
Mosquito     8 IGLLLLLVLTGGALCQTLYEGDPCELRDGSAGVCTDATDCPWFLEVIVKNRRFA---DRVSCGFD 69

  Fly    65 -VSTAICCPKN----LIIKEPRLIINEPITDPQCGFVNSKGVTFSFREEDTGLAQEAEVPWMVAL 124
             ::..|||..|    |.::. ||         .|..|.......:|...|...|.|.|.|:|.||
Mosquito    70 GLTEVICCKTNGTRPLGVRS-RL---------ACEQVPKYTSRLTFHIIDGEEASEGEFPFMAAL 124

  Fly   125 ---LDARTS---SYVAGGALIAPHVVITARQ-------------RTENMTASQLVVRAGEWDFST 170
               .|..|.   ||..|.::|:...::||..             .|.|:......|..|      
Mosquito   125 GYPTDDETQQNISYRCGASMISTDFLLTAAHCIPTNDRPTVAILGTNNLAPGNHGVLVG------ 183

  Fly   171 KTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFS----R 231
                       :::...||.:......:::|||.|.|.:.:...:||||:     |.|.|    .
Mosquito   184 -----------LKAFFPHPDYRTNRNYHDIALVQLERRIENEPDVNPICL-----NDDLSDLPED 232

  Fly   232 CIFT--GWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLM----------- 283
            .:.|  |:|....|.....|.|.|::|..|..:.|.|..         .|::|:           
Mosquito   233 TVLTAEGYGIIDLDRNLRSNQLMKVNLTTVPWQKCNQTF---------ADSNLLKNNRKLPQGIV 288

  Fly   284 ----CAGGEPGK------DSCEGDGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVA 338
                ||.|...:      |:|:||.|.||  .|.|: .:|:|.|:.:||..|| ...|:|.|.||
Mosquito   289 ATQYCATGRENEEKKVVGDTCQGDSGGPL--QIMDD-GKYKLVGVTSFGNGCG-SNTPSVSTRVA 349

  Fly   339 NVIEWI 344
            ..|:||
Mosquito   350 AYIDWI 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 71/276 (26%)
Tryp_SPc 113..344 CDD:238113 71/276 (26%)
CLIPC6XP_001687772.2 CLIP 31..77 CDD:288855 9/48 (19%)
Tryp_SPc 106..355 CDD:214473 72/283 (25%)
Tryp_SPc 107..358 CDD:238113 74/284 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.