DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and si:dkey-33m11.7

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_021335658.1 Gene:si:dkey-33m11.7 / 565163 ZFINID:ZDB-GENE-141216-115 Length:214 Species:Danio rerio


Alignment Length:232 Identity:61/232 - (26%)
Similarity:95/232 - (40%) Gaps:44/232 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 QLVVRAGEWDFSTK--TEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICM 220
            |::|.||::.....  |||...   |: .::.||.:|......::.|:.|...:..:|:::...:
Zfish     3 QMMVVAGDYTLGANEGTEQYSK---PL-MLIPHPLYNRSTNNADIMLIKLSAPIELNRYVSLAPL 63

  Fly   221 PSAPKNFDFSR-CIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMC 284
            |.........| |..:|||..|.........|:.:.||:|....|... ..:.||   :..:::|
Zfish    64 PKQNTGLLAGRMCRVSGWGSTSHSGGLIPLTLRTVRLPIVSTFKCNSS-SSFSGN---ITANMIC 124

  Fly   285 AGGEP-GKDS---------------CEGDGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAV 333
            ||... |||:               |:||.|.||.|   |.    .:.|:|::|..||.|..|.|
Zfish   125 AGSSTGGKDACKNSTQYLCHLIVYLCQGDSGGPLVC---DG----RVYGLVSWGNGCGDPRFPGV 182

  Fly   334 YTNVANVIEWITLTTVNMPLPEEREEVPYASPTLSAG 370
            ||.|:....||..|..:          .||....|||
Zfish   183 YTAVSRFRRWIDQTIYS----------TYARCLKSAG 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 53/204 (26%)
Tryp_SPc 113..344 CDD:238113 53/204 (26%)
si:dkey-33m11.7XP_021335658.1 Tryp_SPc <2..196 CDD:238113 55/207 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.