DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and PRSS1

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_011514713.1 Gene:PRSS1 / 5644 HGNCID:9475 Length:472 Species:Homo sapiens


Alignment Length:237 Identity:70/237 - (29%)
Similarity:117/237 - (49%) Gaps:28/237 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 QEAEVPWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFST--KTEQLP 176
            :|..||:.|:|   .:..:..||:||....|::|    .:...|::.||.||.:...  ..||. 
Human   256 EENSVPYQVSL---NSGYHFCGGSLINEQWVVSA----GHCYKSRIQVRLGEHNIEVLEGNEQF- 312

  Fly   177 SVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSRCIFTGWGKNS 241
               :....|:|||.::.:...|::.|:.|......:..::.|.:|:||.... ::|:.:|||..:
Human   313 ---INAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLPTAPPATG-TKCLISGWGNTA 373

  Fly   242 FDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGG-EPGKDSCEGDGGSPLACA 305
            .....|.:.|:.:..||:.:..||..   |.|   ::.:::.|.|. |.|||||:||.|.|:.| 
Human   374 SSGADYPDELQCLDAPVLSQAKCEAS---YPG---KITSNMFCVGFLEGGKDSCQGDSGGPVVC- 431

  Fly   306 IKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWITLT 347
               |.|   |.|:|::|..|.....|.|||.|.|.::||..|
Human   432 ---NGQ---LQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNT 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 67/232 (29%)
Tryp_SPc 113..344 CDD:238113 67/232 (29%)
PRSS1XP_011514713.1 Ig 19..119 CDD:299845
IG_like 29..113 CDD:214653
Tryp_SPc 248..464 CDD:214473 67/232 (29%)
Tryp_SPc 249..467 CDD:238113 69/235 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.