DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and f2

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001015797.1 Gene:f2 / 548514 XenbaseID:XB-GENE-481539 Length:607 Species:Xenopus tropicalis


Alignment Length:333 Identity:83/333 - (24%)
Similarity:138/333 - (41%) Gaps:67/333 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 CPKNLI---IKEPRLIINEP----ITDPQCGFVNSK---------GVTFSFRE---EDTG----- 111
            ||.|..   |.|.  ::|.|    .|:....|.:.|         |:...|.:   ||.|     
 Frog   280 CPMNYCDSPIDEE--VLNRPAGRTTTEEHQTFFDEKSFGSGEAVCGLRPLFEQKSVEDKGEKELL 342

  Fly   112 ------------LAQEAEVPWMVALLDARTSSYVAGGALIAPHVVITARQ------RTENMTASQ 158
                        .|:....||.|.|........:.|.:|::...|::|..      ..:|.|...
 Frog   343 ESYMQGRIVKGETAEPGSAPWQVMLFKKSPQELLCGASLLSDRWVLSAAHCIFYPPWDKNYTTDD 407

  Fly   159 LVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFN-LENGANNVALVFLRRSLTSSRHINPICMPS 222
            ::||.|: .|.||.|:.......:..|:.||.:| .||...::||:.|:|.:..|.:|:|:|:|:
 Frog   408 ILVRIGK-HFRTKYERATERIAQLERIIVHPKYNWKENLDRDIALIQLKRPVAFSNYIHPVCLPT 471

  Fly   223 APKNFDFSRCIF----TGWGKN----SFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELD 279
            ...........:    ||||..    :....:....|::|:||:|.:.||:.      ..:.::.
 Frog   472 KDTVVKLLAAGYKGRVTGWGNLQETWTSGAQNLPQALQQINLPIVDQETCKS------STNIKVT 530

  Fly   280 NSLMCAGGEPGK----DSCEGDGGSPLACAIKD-NPQRYELAGIVNFGVDCGLPGVPAVYTNVAN 339
            :::.|||..|..    |:||||.|.|.  .:|| :..|:...|||::|..|........|.:|..
 Frog   531 DNMFCAGYNPEDSKRGDACEGDSGGPF--VMKDPDTGRWVQLGIVSWGEGCDRDNKYGFYVHVHR 593

  Fly   340 VIEWITLT 347
            :.:||..|
 Frog   594 MRKWIMKT 601

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 65/250 (26%)
Tryp_SPc 113..344 CDD:238113 65/250 (26%)
f2NP_001015797.1 GLA 23..86 CDD:214503
KR 106..185 CDD:214527
KR 206..287 CDD:214527 3/6 (50%)
Thrombin_light 303..349 CDD:370463 8/45 (18%)
Tryp_SPc 349..598 CDD:214473 65/257 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.