DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and C1s1

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001091086.1 Gene:C1s1 / 50908 MGIID:1355312 Length:694 Species:Mus musculus


Alignment Length:307 Identity:84/307 - (27%)
Similarity:133/307 - (43%) Gaps:47/307 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 YRNLGCVSTAICCPKNLIIKEPRLIINEPITDPQCGFVNSKGVTFSFREEDTGLAQEAEV---PW 120
            ||   |.:........|.|:.||.|       |.||....   .|...:...| .|.|::   ||
Mouse   407 YR---CAANGRWVNDQLGIELPRCI-------PACGVPTE---PFQVHQRIFG-GQPAKIENFPW 457

  Fly   121 MVALLDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVD-VPIRS 184
            .|.....|     |.||||..:.|:||....|.::...:.|..    .|.:|..|.:.. :..:.
Mouse   458 QVFFNHPR-----ASGALINEYWVLTAAHVLEKISDPLMYVGT----MSVRTTLLENAQRLYSKR 513

  Fly   185 IVRHPGFNLE-------NGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFS---RCIFTGWGK 239
            :..||.:..|       |..|::|||.|:..:.....::|||:|.....::.|   ..:.:||| 
Mouse   514 VFIHPSWKKEDDPNTRTNFDNDIALVQLKDPVKMGPKVSPICLPGTSSEYNVSPGDMGLISGWG- 577

  Fly   240 NSFDDPSYMNVLKKISLPVVQRRTCEQ---QLRLYYGNDFELDNSLMCAGGEPGKDSCEGDGGSP 301
             |.:...::..|:...:||....||:|   :.......|:...::::|| ||.|.|||.||.|..
Mouse   578 -STEKKVFVINLRGAKVPVTSLETCKQVKEENPTVRPEDYVFTDNMICA-GEKGVDSCHGDSGGA 640

  Fly   302 LACAIKD-NPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWITLT 347
            .|..:.: ...::.:||:|::|..||..|   |||.|.|.::||..|
Mouse   641 FAFQVPNVTVPKFYVAGLVSWGKRCGTYG---VYTKVKNYVDWILKT 684

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 68/248 (27%)
Tryp_SPc 113..344 CDD:238113 68/248 (27%)
C1s1NP_001091086.1 CUB 24..135 CDD:238001
FXa_inhibition 149..177 CDD:373209
CUB 181..293 CDD:366096
CCP 307..361 CDD:153056
CCP 365..428 CDD:153056 7/23 (30%)
Tryp_SPc 443..681 CDD:214473 69/253 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.