DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and Prss36

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_038942639.1 Gene:Prss36 / 497040 RGDID:1593186 Length:874 Species:Rattus norvegicus


Alignment Length:360 Identity:95/360 - (26%)
Similarity:147/360 - (40%) Gaps:72/360 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 PRLIINEPITDPQCGFVNSKGVT---FSFREEDTGL------------AQEAEVPWMVALLDART 129
            |.|:.:  :..|..|......|:   ..|.:.|.|.            |.....||.|:|  ...
  Rat    19 PHLVFS--VVSPTPGAFQDSAVSPTQGEFEDLDCGRPEPSSRIVGGSDAHPGTWPWQVSL--HHG 79

  Fly   130 SSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWD--FSTKTEQLPSVDVPIRSI----VRH 188
            ..::.||:||||..|::|   ......:..:..|.||.  ....::..|.....:||:    |..
  Rat    80 GGHICGGSLIAPSWVLSA---AHCFVTNGTLEPADEWSVLLGVHSQDGPLEGAHMRSVATILVPD 141

  Fly   189 PGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDF-SRCIFTGWGKNSFDDPSYMN-VL 251
            ....:|.|| ::||:.|.........:.|:|:|.|...|.. :.|..||||.....||..:. ||
  Rat   142 NYSRVELGA-DLALLRLASPAKLGPSVKPVCLPRASHLFAHGTACWATGWGDVQESDPLPVPWVL 205

  Fly   252 KKISLPVVQRRTCEQQLRLY-----YGNDFELDNSLMCAGGEPG-KDSCEGDGGSPLACAIKDNP 310
            :::.|.::....|:   .||     :....:|...::|||...| :|:|:||.|.||.|   ::.
  Rat   206 QEVELKLLGETACQ---CLYSRPGPFNLTLQLLPGMLCAGYPEGRRDTCQGDSGGPLVC---EDG 264

  Fly   311 QRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWITLTTVNMPLPEEREEVPYASPTLSAGP-YLN 374
            .|:.||||.:||..||....|.|:|.||:...||            ||.|..:.|    || :.:
  Rat   265 GRWFLAGITSFGFGCGRRNRPGVFTAVAHYESWI------------REHVMGSEP----GPAFPS 313

  Fly   375 QWNQPNYEWLPTGYPNVNSIPWQLQEANNDLANSQ 409
            |..:|..|            ||:.:|.|...|..:
  Rat   314 QLQKPPSE------------PWEPREENCTFAQPE 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 71/244 (29%)
Tryp_SPc 113..344 CDD:238113 71/244 (29%)
Prss36XP_038942639.1 Tryp_SPc 59..301 CDD:238113 74/265 (28%)
Tryp_SPc 338..532 CDD:419748
Tryp_SPc 607..802 CDD:419748
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.