DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and AgaP_AGAP009216

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_001238238.1 Gene:AgaP_AGAP009216 / 4578289 VectorBaseID:AGAP009216 Length:244 Species:Anopheles gambiae


Alignment Length:241 Identity:71/241 - (29%)
Similarity:111/241 - (46%) Gaps:30/241 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 EVPWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQ----LPS 177
            ::|| .|||...:..:....:||:...|:|.....:|...:.:.:|..:.|     ||    |..
Mosquito    15 QLPW-TALLKTSSGEFACAASLISERYVLTVAHCIKNRNVTFVQLRKKDCD-----EQGVCTLAP 73

  Fly   178 VDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSRCIFTGWGKNSF 242
            .|:|:...:.|.||:.....|::|||.|.::::.:..:.|||:|.||:        :...|.|.|
Mosquito    74 QDIPVERAIAHDGFSARRKLNDIALVRLAQNVSFNNDVLPICLPVAPE--------YQPAGSNYF 130

  Fly   243 ---DDPSYMNV-LKKISLPVVQRRT---CEQQLRLYYGNDFELDNSLMCAGGEPGK-DSCEGDGG 299
               |...|.:: ...||:..|...|   ||.:|:.......::..|.:| |.|.|. |.|....|
Mosquito   131 TARDGQDYASLNTDTISITEVHPLTTENCENRLQELIKRQHKIQESHIC-GYEAGSFDGCATSAG 194

  Fly   300 SPLACAIKDNPQRYELAGIVNFGV-DCGLPGVPAVYTNVANVIEWI 344
            .||...  |...|....|:|::|| ||.|..||:|||.|.:.|.||
Mosquito   195 GPLVAL--DRFGRNVQHGVVSYGVQDCSLENVPSVYTRVESFINWI 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 69/239 (29%)
Tryp_SPc 113..344 CDD:238113 69/239 (29%)
AgaP_AGAP009216XP_001238238.1 Tryp_SPc 14..238 CDD:214473 69/239 (29%)
Tryp_SPc 14..238 CDD:238113 69/239 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.