DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and AgaP_AGAP010798

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_001231167.2 Gene:AgaP_AGAP010798 / 4577817 VectorBaseID:AGAP010798 Length:276 Species:Anopheles gambiae


Alignment Length:286 Identity:67/286 - (23%)
Similarity:126/286 - (44%) Gaps:43/286 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 ICCPKNLIIKEPR------LIINEPITDPQCGFVNSKGVTFSFREEDTGLAQEAEVPWMVAL--L 125
            :||   |::...|      |.:...::..|         ..|||..:...|.....|::|::  .
Mosquito    18 VCC---LLLYSSRSYLTLSLAVMSEVSAKQ---------KMSFRIVNGTEATIVSYPYVVSIQRW 70

  Fly   126 DARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPG 190
            ..|...::.||.||:...::||....:.::.:.::||... .|..:..:|..|:    .:::|..
Mosquito    71 TPRVKQHICGGTLISESWILTAAHCADKISPTTVMVRVNS-SFFNRGGKLHRVE----KVIKHER 130

  Fly   191 FNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNF-DFSRCIFTGWGKNSFDDPSYMNVLKKI 254
            |:...|..:..|:.|::.......:.   :|...:.| ...||...|||:....:.  ...|:::
Mosquito   131 FSYATGDYDFGLLKLKQRYRRGTFVK---LPERRRRFPPAERCTAMGWGETLGRES--REQLRQV 190

  Fly   255 SLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPG-KDSCEGDGGSPLACAIKDNPQRYELAGI 318
            .:|:|.:..|.   :.|.|.| |:...::|||...| :|:|:||.|.||.|       |...||:
Mosquito   191 VMPIVSQAVCR---KAYEGTD-EITARMLCAGYPEGMRDACDGDSGGPLIC-------RGIQAGV 244

  Fly   319 VNFGVDCGLPGVPAVYTNVANVIEWI 344
            :::.:.|..|....||:::|...|||
Mosquito   245 ISWAIGCAQPNKYGVYSSIAEGREWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 56/234 (24%)
Tryp_SPc 113..344 CDD:238113 56/234 (24%)
AgaP_AGAP010798XP_001231167.2 Tryp_SPc 49..270 CDD:214473 57/241 (24%)
Tryp_SPc 50..273 CDD:238113 58/242 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.