DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and AgaP_AGAP004571

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_313875.2 Gene:AgaP_AGAP004571 / 4576898 VectorBaseID:AGAP004571 Length:324 Species:Anopheles gambiae


Alignment Length:235 Identity:79/235 - (33%)
Similarity:114/235 - (48%) Gaps:22/235 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 EVPWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGE---WDFSTKTEQLPSV 178
            |.|||..|  :..:.:..||.||....|:||....:......:.|..||   .|.|.:    |..
Mosquito    93 EFPWMARL--SYFNRFYCGGMLINDRYVLTAAHCVKGFMWFMIKVTFGEHNRCDDSVR----PET 151

  Fly   179 DVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKN-FDFSRCIFTGWGKNSF 242
            ...:|:|.:.  |:..|..|::||:.|...:..:..|.|||:||.|.| :..:....||||....
Mosquito   152 RFVLRAIAQK--FSFLNFDNDIALLRLNDRVPITDFIRPICLPSDPSNAYVGTNGTATGWGTLKE 214

  Fly   243 D-DPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAG--GEPGKDSCEGDGGSPLAC 304
            | .||.  :|:::.:||:....|..|..  |......|| ::|||  |...||||:||.|.||..
Mosquito   215 DGKPSC--ILQEVEVPVLSNEVCSTQTN--YTASMITDN-MLCAGYLGVGEKDSCQGDSGGPLIA 274

  Fly   305 AIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344
            ..:|  :||||.|:|::|..|..|..|.|||.|...::||
Mosquito   275 ERED--KRYELIGVVSWGNGCARPYYPGVYTRVTRYLDWI 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 77/233 (33%)
Tryp_SPc 113..344 CDD:238113 77/233 (33%)
AgaP_AGAP004571XP_313875.2 Tryp_SPc 82..312 CDD:214473 77/233 (33%)
Tryp_SPc 83..315 CDD:238113 79/235 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.