DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and AgaP_AGAP006710

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_565496.1 Gene:AgaP_AGAP006710 / 4576607 VectorBaseID:AGAP006710 Length:258 Species:Anopheles gambiae


Alignment Length:243 Identity:62/243 - (25%)
Similarity:104/243 - (42%) Gaps:28/243 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 LAQEAEVPWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLP 176
            :|:....|:.|: |......:..||:|:....|:||.........|.|:|..|........|.| 
Mosquito    38 VAKNGSAPYQVS-LQVPGWGHNCGGSLLNNRWVLTAAHCLVGYEPSDLMVLVGTNSLKEGGELL- 100

  Fly   177 SVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPI--CMPSAPKNFDFSRCIFTGWGK 239
            .||    .::.|..:|.....|::.|:.|.:.:..|..:..:  ...:.|.|   :....||||:
Mosquito   101 KVD----KLLYHSRYNRPQFHNDIGLMRLEQPVQFSELVQSVEYLEKAVPVN---ATVRLTGWGR 158

  Fly   240 NSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGKDSCEGDGGSPLAC 304
            .| .:.:...:|:.:::..:....|:.::    ||...:|...:|...:.|:.:|.||.|.||. 
Mosquito   159 TS-TNGNVPTLLQSLNVVTLSNEDCKAKM----GNPENVDLGHVCTLTKAGEGACNGDSGGPLV- 217

  Fly   305 AIKDNPQRYE--LAGIVNFGVDCGLPGVPAVYTNVANVIEWITLTTVN 350
                    ||  |.|:|||||.|| .|.|..:..|:...||:..|..|
Mosquito   218 --------YEGKLVGVVNFGVPCG-RGFPDGFARVSYYHEWVRTTMAN 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 59/234 (25%)
Tryp_SPc 113..344 CDD:238113 59/234 (25%)
AgaP_AGAP006710XP_565496.1 Tryp_SPc 32..250 CDD:214473 59/235 (25%)
Tryp_SPc 33..253 CDD:238113 60/238 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.