DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and cela1.6

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001003737.1 Gene:cela1.6 / 445282 ZFINID:ZDB-GENE-040808-55 Length:266 Species:Danio rerio


Alignment Length:264 Identity:78/264 - (29%)
Similarity:115/264 - (43%) Gaps:46/264 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 FREEDTGLAQEAEV----------PWMVALLDARTSSY--VAGGALIAPHVVITARQRTENMTAS 157
            :.||.  :|||..|          ||.::|......||  ..||.||..:.|:||....:.....
Zfish    20 YLEEQ--IAQERVVGGEVARPNSWPWQISLQYLSGGSYYHTCGGTLIKQNFVLTAAHCVDTSRTW 82

  Fly   158 QLVVRAGEWDFSTK--TEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICM 220
            ::|:  ||.|...:  .||..:|.    ::..||.:|..|.|....:..||  |:|:..:|....
Zfish    83 RVVL--GEHDIYKQEGREQYMTVS----NVYIHPNWNRNNVAAGYDIALLR--LSSNASLNTYVQ 139

  Fly   221 -----PSA---PKNFDFSRCIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFE 277
                 ||.   |.|   :.|..||||..| ...|....||:..||||...||.:  ..::|:  .
Zfish   140 LGTLPPSGQVLPHN---NACYITGWGLTS-TGGSLSAQLKQAYLPVVDYNTCSR--GDWWGS--T 196

  Fly   278 LDNSLMCAGGEPGKDSCEGDGGSPLACAIKDNPQRYELAGIVNF--GVDCGLPGVPAVYTNVANV 340
            :.|:::|||| .....|:||.|.||.|.:..   :|.:.|:.:|  ...|.....|.|:|.|:..
Zfish   197 VKNTMVCAGG-GSLSGCQGDSGGPLNCQVSG---QYVVHGVTSFVSSSGCNAYQKPTVFTRVSAY 257

  Fly   341 IEWI 344
            |.||
Zfish   258 ISWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 74/254 (29%)
Tryp_SPc 113..344 CDD:238113 74/254 (29%)
cela1.6NP_001003737.1 Tryp_SPc 30..264 CDD:238113 73/252 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.