DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CG11313

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster


Alignment Length:403 Identity:107/403 - (26%)
Similarity:163/403 - (40%) Gaps:104/403 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IIAIVSLILVAGQVQAQGQNAELNQSCGASNEHQCVPRHMCKVKIEFRMAMTYRNLGCVSTAICC 71
            :||.|.|.|:..:. |.||..    ||...|:                     |...||:..:|.
  Fly     3 VIAAVLLCLLIIRT-AHGQYV----SCRNPNQ---------------------RTGYCVNIPLCV 41

  Fly    72 PKNLI-------------IKEPRLIINE----------PITD-------PQCGFVNSK------- 99
            |.|.:             |:|.|.::::          |.||       |....::|.       
  Fly    42 PLNSVLAKSNPTDSEMRFIRESRCLVSDQSDLPFVCCTPDTDYNTTRARPNDEVIHSTLLPDRSI 106

  Fly   100 -GVTFSFRE----EDTGLAQEAEVPWMVALLDAR------TSSYVAGG------ALIAPHVVITA 147
             |...::.:    .:|.|   .|..||| ||:.|      ..:|.||.      .:.|.|.|..|
  Fly   107 CGGDIAYNQITKGNETVL---TEFAWMV-LLEYRPHDGQQLRTYCAGSLINNRYVVTAAHCVSAA 167

  Fly   148 RQRTENMTASQLVVRAGEWDFSTKTEQL------PSVDVPIRSIVRHPGFNLENGANNVALVFLR 206
            .:..:...:.::.||.||.:.|...:.|      ..|.:.:..|..|..|......|::||:.|.
  Fly   168 TRARKGDVSFRVSVRLGEHNTSAVVDCLNGRCLPEPVQIAVEEIRIHESFGTRLFWNDIALIRLA 232

  Fly   207 RSLTSSRHINPICMPSAP--KNFDFSRCIFT--GWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQ 267
            |.:..|..|.|:|:||..  :|:...:. ||  |||:....:.|  .|..|:.:..|:...|.::
  Fly   233 REVAYSPSIRPVCLPSTVGLQNWQSGQA-FTVAGWGRTLTSESS--PVKMKLRVTYVEPGLCRRK 294

  Fly   268 LRLYYGNDFELDNSLMCAGGEPGKDSCEGDGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPA 332
                |.:...|.:|.:||.|....|||:||.|.|| .|..:..  :.|.|||:||::||....||
  Fly   295 ----YASIVVLGDSHLCAEGRSRGDSCDGDSGGPL-MAFHEGV--WVLGGIVSFGLNCGSRFWPA 352

  Fly   333 VYTNVANVIEWIT 345
            |||||.:...|||
  Fly   353 VYTNVLSYETWIT 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 76/252 (30%)
Tryp_SPc 113..344 CDD:238113 76/252 (30%)
CG11313NP_651821.3 CLIP 24..78 CDD:288855 11/74 (15%)
Tryp_SPc 116..367 CDD:238113 81/264 (31%)
Tryp_SPc 116..364 CDD:214473 78/261 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457336
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.