DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and Tmprss11c

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001025468.1 Gene:Tmprss11c / 435845 MGIID:3521861 Length:431 Species:Mus musculus


Alignment Length:247 Identity:76/247 - (30%)
Similarity:120/247 - (48%) Gaps:34/247 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 AQEAEVPWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAG---EW----DFST 170
            |:|.|.||..:|  .:.|.:..|..||:.:.:|         ||:...:||.   :|    .|..
Mouse   206 AEEGEWPWQASL--QQNSVHRCGATLISNYWLI---------TAAHCFIRAANPKDWKVSFGFLL 259

  Fly   171 KTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNF-DFSRCIF 234
            ...|.|..   :::|:.|..::.....|::|:|.|...:....:|...|:|.|.:.| ..|..:.
Mouse   260 SKPQAPRA---VKNIIIHENYSYPAHDNDIAVVRLSSPVLYESNIRRACLPEATQKFPPNSDVVV 321

  Fly   235 TGWG--KNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGK-DSCEG 296
            ||||  |:..|.|   |:|:|..:.::..:||... :.|.|   .:...:||||...|: |:|:|
Mouse   322 TGWGTLKSDGDSP---NILQKGKVKIIDNKTCNSG-KAYGG---MITPGMMCAGFLKGRVDACQG 379

  Fly   297 DGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWITLTT 348
            |.|.||..  :|:...:.|||||::|.:|.||..|.|||.|....:|||..|
Mouse   380 DSGGPLVS--EDSKGIWFLAGIVSWGDECALPNKPGVYTRVTYYRDWITSKT 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 72/241 (30%)
Tryp_SPc 113..344 CDD:238113 72/241 (30%)
Tmprss11cNP_001025468.1 SEA 62..157 CDD:279699
Tryp_SPc 199..425 CDD:214473 72/241 (30%)
Tryp_SPc 200..428 CDD:238113 75/244 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.