DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CG11841

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:298 Identity:84/298 - (28%)
Similarity:128/298 - (42%) Gaps:41/298 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 ICCPK-NLIIKEPRLIINEPITDPQCGFVNSKGVTFSFREE---------DTGLAQEAEVPWMVA 123
            :.|.| ..|:.|.|:.|:...||..        :|:...:.         |...|:..|.|:...
  Fly    32 LACTKFKQIVFEERVAISFFFTDAP--------ITYETVDSCHGSRPLIVDGTPAEPKEFPFAAR 88

  Fly   124 LLDARTSS---YVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVPIRSI 185
            |...:|::   :..||.||:..:|:||.....:......|||.||.:|.|.|:.....|..:.::
  Fly    89 LGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRLGELEFDTDTDDAEPEDFGVLAL 153

  Fly   186 VRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFD----FSRCIFTGWGKNSFDDPS 246
            ..||||......|::.:|.|.|.:..:|:.:|.|:|     ||    ....|..|||:..|....
  Fly   154 KAHPGFENPQLYNDIGIVQLDREVKFNRYKHPACLP-----FDDGEQHESFIAIGWGQKKFAQKE 213

  Fly   247 YMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDN-----SLMCAGGEPGKDSCEGDGGSPLACAI 306
            ...:| |:.|...:.| |...:.   .|| ||.|     |.:|.|....||:|.||.|.|:....
  Fly   214 SKKLL-KVQLQGYKDR-CVSSVD---AND-ELPNGYEPKSQLCIGSRDNKDTCNGDSGGPVLAYH 272

  Fly   307 KDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344
            ||....|.:.||.:.|:.|..|.:|:.||.|...:.||
  Fly   273 KDLACMYHVMGITSAGITCSTPDIPSAYTRVHYFLNWI 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 72/242 (30%)
Tryp_SPc 113..344 CDD:238113 72/242 (30%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 75/250 (30%)
Tryp_SPc 72..310 CDD:214473 73/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.