DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CG7432

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_650825.2 Gene:CG7432 / 42347 FlyBaseID:FBgn0038727 Length:721 Species:Drosophila melanogaster


Alignment Length:285 Identity:79/285 - (27%)
Similarity:126/285 - (44%) Gaps:48/285 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 INEPITDP-QCGFVNSKGVTFSFREEDTGL------AQEAEVPWMVALL--DARTSSYVAGGALI 139
            |...|.|| :||          .:|..||.      |...:.|||.|:.  ..:.:.:..||:||
  Fly   455 IGNNIVDPDECG----------QQEYSTGRIVGGVEAPNGQWPWMAAIFLHGPKRTEFWCGGSLI 509

  Fly   140 APHVVITAR-----QRTENMTASQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFNLENGANN 199
            ....::||.     .|.:...|.|..||.|:.|.||..|....|...::.:..|..|:.....|:
  Fly   510 GTKYILTAAHCTRDSRQKPFAARQFTVRLGDIDLSTDAEPSDPVTFAVKEVRTHERFSRIGFYND 574

  Fly   200 VALVFLRRSLTSSRHINPICMPSA----PK-NFDFSRCIFTGWGKNSFDDPSYMNVLKKISLPVV 259
            :|::.|.:.:..|:::.|:|:|..    || .....|....|||...:......: .::..||:.
  Fly   575 IAILVLDKPVRKSKYVIPVCLPKGIRMPPKERLPGRRATVVGWGTTYYGGKESTS-QRQAELPIW 638

  Fly   260 QRRTCEQQLRLYYGNDFELDNSLMCAG-GEPGKDSCEGDGGSPLACAIKDNPQRYE----LAGIV 319
            :...|:   |.|:.   .::.:.:||| .:.|.|:|:||.|.||.       .||:    ..|:|
  Fly   639 RNEDCD---RSYFQ---PINENFICAGYSDGGVDACQGDSGGPLM-------MRYDSHWVQLGVV 690

  Fly   320 NFGVDCGLPGVPAVYTNVANVIEWI 344
            :||..||.||.|.|||.|...::||
  Fly   691 SFGNKCGEPGYPGVYTRVTEYLDWI 715

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 68/247 (28%)
Tryp_SPc 113..344 CDD:238113 68/247 (28%)
CG7432NP_650825.2 CLIP 335..378 CDD:197829
Tryp_SPc 474..715 CDD:214473 68/254 (27%)
Tryp_SPc 475..718 CDD:238113 70/255 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.