DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CG5246

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:340 Identity:81/340 - (23%)
Similarity:131/340 - (38%) Gaps:85/340 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IAIVSLILVAGQVQAQGQNAELNQSCGASNEHQCVPRHMCKVKIEFRMAMTYRNLGCVSTAICCP 72
            :.::|::::..|             |.|.:           |||..|..:.: :||.|.      
  Fly     4 LVLISVLVILSQ-------------CSAKS-----------VKIHRRHQLNH-HLGHVK------ 37

  Fly    73 KNLIIKEPRLIINEPITDPQCGFVNSKGVTFSFREEDTGLAQEAEVPWMVALLDARTSSYVAGGA 137
                 .|.|:|          |.|:|          .||.|     |:.|::::. ...:|.||:
  Fly    38 -----PETRVI----------GGVDS----------PTGFA-----PYQVSIMNT-FGEHVCGGS 71

  Fly   138 LIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFNLENGANNVAL 202
            :|||..::||....| .....|.:..|..|::.     |..:..:.....|...:.....|::||
  Fly    72 IIAPQWILTAAHCME-WPIQYLKIVTGTVDYTR-----PGAEYLVDGSKIHCSHDKPAYHNDIAL 130

  Fly   203 VFLRRSLTSSRHINPICMP---SAPKNFDFSRCIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTC 264
            :...:.:.......||.:.   |.||..|  :...||||... ....|...|:||.|..:....|
  Fly   131 IHTAKPIVYDDLTQPIKLASKGSLPKVGD--KLTLTGWGSTK-TWGRYSTQLQKIDLNYIDHDNC 192

  Fly   265 EQQLRLYYGNDFELDNSLMCAGGEPGKDSCEGDGGSPLACAIKDNPQRYELAGIVNFGVDCGLPG 329
            :.::|    |...|....:|...:.|:.||.||.|.||..|      ...|.|:||:|..|.: |
  Fly   193 QSRVR----NANWLSEGHVCTFTQEGEGSCHGDSGGPLVDA------NQTLVGVVNWGEACAI-G 246

  Fly   330 VPAVYTNVANVIEWI 344
            .|.|:.:||...:||
  Fly   247 YPDVFGSVAYYHDWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 60/233 (26%)
Tryp_SPc 113..344 CDD:238113 60/233 (26%)
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 67/265 (25%)
Tryp_SPc 42..263 CDD:238113 68/266 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.