DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CG31266

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:245 Identity:70/245 - (28%)
Similarity:106/245 - (43%) Gaps:32/245 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 AQEAEVPWMVALLDARTSSYVAGGALIAPHV-VITARQRTENMTASQLVVRAGE---WDFSTKTE 173
            |.|...||:.::.:|  .||...||:|.... |:||......:....|:|..|.   ||......
  Fly    58 AAEGNWPWIASIQNA--YSYHLCGAIILDETWVLTAASCVAGLRPLNLLVVTGTVDWWDLYAPYY 120

  Fly   174 QLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSRCIFTGWG 238
            .:..:.|       |..|:.....|::||:.|...:..:.....|.:....:..:..:..|.|||
  Fly   121 TVSQIHV-------HCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDELEEGDKLTFAGWG 178

  Fly   239 KNSFDDPSYMNVLKKIS---LPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGKDSCEGDGGS 300
             :|....:|...|::.|   |||   ..|.::|:    |..::|...:|...:.|:.:|.||.|.
  Fly   179 -SSEAMGTYGRYLQEASGTYLPV---DACREKLQ----NQDDVDLGHVCVQMDAGQGACHGDTGG 235

  Fly   301 PLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWITLTTVN 350
            ||.    |..||  |.||.|:||.|| .|.|.||...|...:||. ||:|
  Fly   236 PLI----DEQQR--LVGIGNWGVPCG-RGYPDVYARTAFYHDWIR-TTMN 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 65/237 (27%)
Tryp_SPc 113..344 CDD:238113 65/237 (27%)
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 65/237 (27%)
Tryp_SPc 52..275 CDD:238113 67/241 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.