DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CG14088

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster


Alignment Length:302 Identity:76/302 - (25%)
Similarity:115/302 - (38%) Gaps:63/302 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 EEDTGLAQEAEVPWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTK 171
            |...||:.:...||...|  ......|..|.||....::|.....:::.    |:||...::...
  Fly    33 ERRDGLSPDIVGPWTAIL--HHFGRIVGVGTLIHERFILTDVHCGDSIG----VIRARLGEYGRI 91

  Fly   172 TEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPIC--MPSAPKNFDFSRCIF 234
            ..:| :.|..:.:...:..||.|..|||:.|:.|.|::....||.|:|  |.|..:.|......|
  Fly    92 GSEL-AEDHIVAAFFSNANFNPETQANNMGLMKLLRTVVYKEHIIPVCILMDSRMQTFADELDYF 155

  Fly   235 TG--WGKNSFDDPSYMNVLKK---ISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGKDSC 294
            .|  | |||...|    :|:.   |.:|    :.|.           :||:...|| |....|||
  Fly   156 NGTTW-KNSDKSP----MLRSKTVIRMP----QACG-----------KLDHGQFCA-GHKDLDSC 199

  Fly   295 EGDGGSPLACAIK-DNPQRYELAGIVN-FGVDCGLPGVPAVYTNVANVIEWITL------TTVNM 351
            :...|:.|...|. ..|.|..|.||.| ..|.|   .....||:|..:.:||::      |...|
  Fly   200 DEPSGAALTREIDYIGPNRTVLFGIANSVEVKC---SNSRTYTDVVQLHQWISMVIYSSNTNDGM 261

  Fly   352 PLPEEREEVPYASPTLSAGPYLNQWNQPNYEWLPTGYPNVNS 393
            ..|.....:|                :|.:|...|.: :.||
  Fly   262 DKPHNTTHLP----------------EPVFELKSTSF-STNS 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 62/239 (26%)
Tryp_SPc 113..344 CDD:238113 62/239 (26%)
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 64/239 (27%)
Tryp_SPc 42..248 CDD:214473 62/236 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.