DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and Jon74E

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster


Alignment Length:244 Identity:63/244 - (25%)
Similarity:105/244 - (43%) Gaps:29/244 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 LAQEAEVPWMVAL-LDARTSSYV-AGGALIAPHVVITARQRTENMTASQL----VVRAGEWDFST 170
            ||:..:.|:.|.| ::.....|. .|.:||:...::||....|...|...    |:|........
  Fly    37 LARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLGGVLRLAPRQLIR 101

  Fly   171 KTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMP---SAPKNFDFSRC 232
            .|.  |.|.:       ||.:|.::..|::|||.|.........|.||.:|   |:..::|:...
  Fly   102 STN--PEVHL-------HPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPA 157

  Fly   233 IFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGKDSCEGD 297
            |.:|||:.:.:..:..:.|:.:...|.....||..    |.|   :..:.:|.....||.:|.||
  Fly   158 IASGWGRMNDESTAISDNLRYVYRFVESNEDCEYS----YAN---IKPTNICMDTTGGKSTCTGD 215

  Fly   298 GGSPLACAIKDNPQRYE-LAGIVNFGVDCG-LPGVPAVYTNVANVIEWI 344
            .|.||  ...|..|..: |.|:.::|...| ..|.|:|:|.:...::||
  Fly   216 SGGPL--VYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 60/241 (25%)
Tryp_SPc 113..344 CDD:238113 60/241 (25%)
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 61/242 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.