DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CG4914

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster


Alignment Length:269 Identity:81/269 - (30%)
Similarity:126/269 - (46%) Gaps:32/269 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 PITDPQCGFVNSK-----GVTFSFREEDTGLAQEAEVPWMVALLDARTSSYVAGGALIAPHVVIT 146
            |....:||..|.:     |.|       ||:   :|.|||..|  :..:.:..||.||....|:|
  Fly   113 PTCSCRCGERNDESRIVGGTT-------TGV---SEYPWMARL--SYFNRFYCGGTLINDRYVLT 165

  Fly   147 ARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTS 211
            |....:......:.|..||.|.....|: |.....:|:..:.  |:..|..|::||:.|...:..
  Fly   166 AAHCVKGFMWFMIKVTFGEHDRCNDKER-PETRFVLRAFSQK--FSFSNFDNDIALLRLNDRVPI 227

  Fly   212 SRHINPICMPSAPKNFDF---SRCIFTGWGKNSFD-DPSYMNVLKKISLPVVQRRTCEQQLRLYY 272
            :..|.|||:|...:..|.   ::.|.||||....| .||.:  |:::.:||:....|..|..  |
  Fly   228 TSFIRPICLPRVEQRQDLFVGTKAIATGWGTLKEDGKPSCL--LQEVEVPVLDNDECVAQTN--Y 288

  Fly   273 GNDFELDNSLMCAG--GEPGKDSCEGDGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYT 335
            .... :..::||:|  |..|:|||:||.|.||. .::.:.:|:|..|||::|..|..|..|.|||
  Fly   289 TQKM-ITKNMMCSGYPGVGGRDSCQGDSGGPLV-RLRPDDKRFEQIGIVSWGNGCARPNYPGVYT 351

  Fly   336 NVANVIEWI 344
            .|...::||
  Fly   352 RVTKYLDWI 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 71/236 (30%)
Tryp_SPc 113..344 CDD:238113 71/236 (30%)
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 75/253 (30%)
Tryp_SPc 128..363 CDD:238113 77/254 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.